Recombinant Mouse Serum amyloid A-1 protein (Saa1)

In Stock
Code CSB-EP020656MO
Abbreviation Recombinant Mouse Saa1 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Saa1; Serum amyloid A-1 protein
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
20-122aa
Target Protein Sequence
GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of recombinant mouse Serum amyloid A-1 protein (Saa1) in E. coli involves several steps. First, the gene encoding the full length of the mature Saa1 protein (20-122aa) is co-cloned into an expression vector with an N-terminal 6xHis-SUMO-tag gene and transformed into E. coli cells. The bacteria are cultured under conditions that induce protein expression. After sufficient growth, the cells are lysed to release the recombinant Saa1 protein. The recombinant Saa1 protein is purified by affinity chromatography. Protein purity is assessed using SDS-PAGE, reaching up to 90%.

Mouse Saa1 is a member of the serum amyloid A family of apolipoproteins, known for its role as a sensitive acute-phase high-density lipoprotein [1]. Saa1 is predominantly secreted by hepatocytes and is widely accepted as an accurate and sensitive indicator of inflammation [2][3]. It is involved in immunomodulation in both sterile and non-sterile inflammation, regulating inflammation and immunity [4][5]. Saa1 has been identified as a potential prediction biomarker for metastasis of hepatocellular carcinoma [6]. Additionally, Saa1 induces inflammation, proliferation, and cell death in activated hepatic stellate cells [7].

Saa1 plays a crucial role in various physiological processes. It is involved in extracellular matrix remodeling in the human amnion, with implications for fetal membrane rupture. Moreover, Saa1 participates in parturition by being synthesized de novo in the placenta. In the context of sepsis-induced lung injury, mouse bone marrow mesenchymal stem cells have been found to inhibit lung injury via exosomal Saa1.

References:
[1] M. Yu, X. Li, Q. Li, S. Mo, N. Yin, F. Hanet al., Saa1 increases nox4/ros production to promote lps-induced inflammation in vascular smooth muscle cells through activating p38mapk/nf-κb pathway, BMC Molecular and Cell Biology, vol. 20, no. 1, 2019. https://doi.org/10.1186/s12860-019-0197-0
[2] S. Siegmund, M. Schlosser, F. Schildberg, E. Seki, S. Minicis, H. Uchinamiet al., Serum amyloid a induces inflammation, proliferation and cell death in activated hepatic stellate cells, Plos One, vol. 11, no. 3, p. e0150893, 2016. https://doi.org/10.1371/journal.pone.0150893
[3] Y. Wang, W. Wang, L. Wang, Y. Bao, J. Lu, Y. Lüet al., Extracellular matrix remodeling effects of serum amyloid a1 in the human amnion: implications for fetal membrane rupture, American Journal of Reproductive Immunology, vol. 81, no. 1, 2018. https://doi.org/10.1111/aji.13073
[4] X. Gan, W. Wang, J. Lu, L. Ling, Q. Zhou, H. Zhanget al., De novo synthesis of saa1 in the placenta participates in parturition, Frontiers in Immunology, vol. 11, 2020. https://doi.org/10.3389/fimmu.2020.01038
[5] Y. Wang, F. Cao, Y. Wang, G. Yu, & B. Jia, Silencing of saa1 inhibits palmitate- or high-fat diet induced insulin resistance through suppression of the nf-κb pathway, Molecular Medicine, vol. 25, no. 1, 2019. https://doi.org/10.1186/s10020-019-0075-4
[6] G. Li, Q. Shen, H. Xu, Y. Zhou, C. Li, Y. Liet al., Saa1 identified as a potential prediction biomarker for metastasis of hepatocellular carcinoma via multi-omics approaches, Frontiers in Oncology, vol. 13, 2023. https://doi.org/10.3389/fonc.2023.1138995
[7] L. Zhou, S. Duan, M. Zhou, M. Gu, S. Liu, Y. Wanget al., Mouse bone marrow mesenchymal stem cells inhibit sepsis-induced lung injury in mice via exosomal saa1, Molecular Pharmaceutics, vol. 19, no. 11, p. 4254-4263, 2022. https://doi.org/10.1021/acs.molpharmaceut.2c00542

Citations

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Major acute phase protein.
Gene References into Functions
  1. Study concludes that the transfer of serum amyloid A1 protein depends on direct cell-to-cell contacts or tunneling nanotubes. PMID: 28361953
  2. High SAA1 expression in the stromal component is associated with pancreatic tumors. PMID: 29351990
  3. findings show that high-density lipoprotein binding blocks fibril formation from soluble SAA1 protein, whereas internalization into mononuclear phagocytes leads to formation of amyloid; SAA1 aggregation in the cell model disturbs the integrity of vesicular membranes and leads to lysosomal leakage and apoptotic death PMID: 28637682
  4. These findings suggest that A-SAA is functionally linked to pulmonary inflammation in this O3 exposure model and that A-SAA could be an important systemic signal of O3 exposure to the CNS.- PMID: 28533327
  5. SAA and TLR4 have a role in skin inflammation PMID: 27502577
  6. Data indicate that SAA1 overexpressing mice (TG) show significant deficits in social behaviors, including impaired social recognition and reduced social interaction. Study detected exogenous SAA1 expression in the brain of TG mice, implying that liver-derived SAA1 migrates to the brain. Results show an increase in the accumulation of the 87kDa form of Abeta in TG mice compared to wild type mice. PMID: 27608955
  7. Sustained, elevated levels of SAA1 were correlated with metabolic parameters and local cytokine expression in the liver following 16 weeks on the high-fat diet. We suggest that SAA1-derived amyloid deposition under long-term high-fat diet exposure may be associated with the complications of high-fat diet-induced obesity and metabolic disorders. PMID: 27218680
  8. Serum Amyloid A induces inflammation, proliferation and cell death in activated hepatic stellate cells. PMID: 26937641
  9. Thermal transitions in serum amyloid A in solution and on the lipid: implications for structure and stability of acute-phase HDL PMID: 26022803
  10. Serum amyloid A1alpha induces paracrine IL-8/CXCL8 via TLR2 and directly synergizes with this chemokine via CXCR2 and formyl peptide receptor 2 to recruit neutrophils. PMID: 26297794
  11. Robust IL-17A production was restricted to the ileum, where SFB makes direct contact with the epithelium and induces serum amyloid A proteins 1 and 2 (SAA1/2), which promote local IL-17A expression in RORgammat(+) T17 cells. PMID: 26411290
  12. SAA protein levels increased in both serum and lung within 2-24h after mice were exposed to Aspergillus spores. SAA mRNA levels increased within the first hour after mice were exposed to A. fumigatus. PMID: 23603100
  13. Saa1 might be a novel inflammatory factor that acts as a chemokine modulator in hepatitis. PMID: 25847238
  14. GAGs may have an intrinsic and divergent influence on the aggregation and fibrillation of HDL-free SAA1.1 in vivo PMID: 24878279
  15. CE/J mice possess functional Saa1 and Saa2 genes with identical amino acid sequence. PMID: 24228751
  16. we find no evidence that adipose tissue-derived hSAA1 influences the development of insulin resistance or obesity-related inflammation. PMID: 23967285
  17. Its gene hold broader diversity and greater complexity and these characteristics were likely attained through gene duplication and repeated gene conversion events in the Mus lineage. PMID: 24521869
  18. The absence of endogenous SAA1.1 and 2.1 does not affect atherosclerotic lipid deposition in apolipoprotein E-deficient mice fed either normal or Western diets. PMID: 24265416
  19. SAA up-regulates Lp-PLA2 production significantly via a FPRL1/MAPKs./PPAR-gamma signaling pathway. PMID: 23623642
  20. Pathogenic serum amyloid A 1.1 shows a long oligomer-rich fibrillation lag phase contrary to the highly amyloidogenic non-pathogenic SAA2.2 PMID: 23223242
  21. An increase in plasma SAA directly accelerates the progression of atherosclerosis in ApoE-/- mice. PMID: 21953420
  22. SAA does not impact High Density Lipoprotein levels, apoA-I clearance, or High Density Lipoprotein size PMID: 20667817
  23. Infusions of SAA-positive cells promote renal recovery after acute renal failure and offer a potentially powerful and novel therapy of renal failure. PMID: 20534870
  24. Serum amyloid A has a role in promoting cholesterol efflux mediated by scavenger receptor B-I PMID: 16120612
  25. Plasma A-SAA elevation was due to induction of Saa1 and Saa2 expression in liver but not in adipose tissue. PMID: 18584041

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
SAA family
Tissue Specificity
Detected in blood plasma (at protein level). Detected in liver.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*