Recombinant Mouse Small proline-rich protein 2A1 (Sprr2a1)

In Stock
Code CSB-EP022612MO
Abbreviation Recombinant Mouse Sprr2a1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Sprr2a1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Sprr2a1; Sprr2a; Small proline-rich protein 2A1; small proline-rich protein 2A
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-83aa
Target Protein Sequence
MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
13.4kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant mouse small proline-rich protein 2A1 (Sprr2a1) production in E. coli involves co-inserting the gene of interest (1-83aa of mouse Sprr2a1) into an expression vector with an N-terminal 6xHis-tag gene and transforming it into E. coli cells. The cells are cultured under conditions that induce protein expression. After sufficient growth, the cells are lysed to release the recombinant Sprr2a1 protein. The obtained recombinant Sprr2a1 protein is purified through the affinity chromatography technique. The purity of the Sprr2a1 protein is assessed using SDS-PAGE, exceeding 90%.

SPRR2a1 is a member of the small proline-rich protein (SPRR) family, which is essential for forming the cornified cell envelope (CE) in various tissues, such as the skin and uterus. The CE serves as a protective barrier against environmental stress and dehydration [1]. SPRR2a1 is implicated in allergic inflammation and is upregulated in response to IL-6/STAT3 signaling [2]. Studies have demonstrated that SPRR proteins are closely associated with genes encoding other structural proteins like keratin and are vital for maintaining barrier function in the skin [3][4].

Moreover, research has shown that estrogen regulates SPRR2a1 in the mouse uterus [5]. The expression of SPRR proteins, including SPRR2a1, is influenced by hormonal fluctuations during the estrous cycle and pregnancy [5]. This underscores the significance of SPRR proteins in the female reproductive system.

References:
[1] H. Lee, H. Kim, Y. Lee, S. Lee, W. Kim, S. Hanet al., Immunolocalisation and oestrogen regulation of small proline-rich protein 2a protein in the mouse uterus, Reproduction Fertility and Development, vol. 26, no. 5, p. 682, 2014. https://doi.org/10.1071/rd12408
[2] I. Nozaki, J. Lunz, S. Specht, D. Stolz, K. Taguchi, В. Субботинet al., Small proline-rich proteins 2 are noncoordinately upregulated by il-6/stat3 signaling after bile duct ligation, Laboratory Investigation, vol. 85, no. 1, p. 109-123, 2005. https://doi.org/10.1038/labinvest.3700213
[3] J. Segre, Epidermal barrier formation and recovery in skin disorders, Journal of Clinical Investigation, vol. 116, no. 5, p. 1150-1158, 2006. https://doi.org/10.1172/jci28521
[4] N. Zimmermann, M. Doepker, D. Witte, K. Stringer, P. Fulkerson, S. Popeet al., Expression and regulation of small proline-rich protein 2 in allergic inflammation, American Journal of Respiratory Cell and Molecular Biology, vol. 32, no. 5, p. 428-435, 2005. https://doi.org/10.1165/rcmb.2004-0269oc
[5] Y. Tan, X. Sun, F. Li, S. Tang, Y. Piao, & Y. Wang, Gene expression pattern and hormonal regulation of small proline-rich protein 2 family members in the female mouse reproductive system during the estrous cycle and pregnancy, Reproduction Nutrition Development, vol. 46, no. 6, p. 641-655, 2006. https://doi.org/10.1051/rnd:2006037

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
Subcellular Location
Cytoplasm.
Protein Families
Cornifin (SPRR) family
Database Links

KEGG: mmu:100042514

UniGene: Mm.359329

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*