Recombinant Mouse Stefin-1 (Stfa1)

In Stock
Code CSB-EP336025MO
Abbreviation Recombinant Mouse Stfa1 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Stfa1
Uniprot No.
Research Area
Others
Alternative Names
Stfa1; Stf-1; Stf1Stefin-1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-97aa
Target Protein Sequence
MSLGGVSEASRATPEIQMIANKVRPQLEAKTNKKYEKFEAVEYKTQVVAGENIFIKMDVGHGCFIHIKVFNGPTGKDNYELHGYQTDKTMDEELTYF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Stefin-1 (Stfa1) represents a full-length protein expressed in E.coli, spanning amino acids 1 to 97. The protein includes an N-terminal 6xHis-tag, which appears to streamline purification and detection processes. SDS-PAGE analysis confirms the product maintains purity levels above 85%, suggesting reliable performance in research settings. This research-grade product shows low endotoxin levels that may be suitable for diverse experimental conditions.

Stefin-1 functions as a cysteine protease inhibitor and seems to play an important role in controlling proteolytic activity within cells. As part of the cystatin family, it likely participates in pathways that govern protein degradation. The protein appears essential for cellular balance and often draws attention in research where tight protease control is necessary. Its significance extends across multiple research fields, particularly cell biology and enzymology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse Stefin-1 is a cysteine protease inhibitor that requires precise folding, proper tertiary structure, and specific reactive site conformation for its functional activity in protease inhibition. The E. coli expression system may not provide the optimal eukaryotic folding environment for this mammalian protein, but Stefin-1 is a relatively small protein (97 aa) without complex post-translational modifications, increasing the probability of correct folding. The N-terminal 6xHis-tag is small and may cause minimal steric interference. While the full-length protein (1-97aa) contains all functional domains, the probability of correct folding with functional inhibitory activity requires experimental validation of protease inhibition capability.

1. Cysteine Protease Inhibition Studies

This application carries a significant risk without functional validation. Stefin-1's inhibitory activity requires precise folding and proper reactive site formation. If correctly folded and active (verified through protease inhibition assays), the protein is suitable for kinetic studies. If misfolded/inactive (unverified), inhibition measurements will yield biologically meaningless results.

2. Protein-Protein Interaction Analysis

This application requires proper folding validation. Stefin-1 interactions with proteases require native conformation. If correctly folded (verified), the protein may identify physiological interaction partners. If misfolded/unverified, there is a risk of non-specific binding or failure to replicate genuine protease-inhibitor interactions.

3. Antibody Development and Validation

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional protein folding. The full-length protein provides comprehensive epitope coverage for generating Stefin-1-specific antibodies. The high purity (>90%) ensures minimal contamination-related issues during immunization protocols.

4. Structural and Biophysical Characterization

These studies are essential for determining folding status. Techniques should include circular dichroism spectroscopy to assess secondary structure, thermal shift assays to evaluate stability, and protease inhibition assays to validate functionality. If correctly folded, results are valuable; if misfolded, they characterize the recombinant construct.

5. Comparative Species Analysis

Meaningful comparative studies require native protein conformation and functional activity. If correctly folded and active (verified), the protein enables valid evolutionary comparisons. If misfolded/inactive (unverified), comparative analyses would yield misleading insights about stefin conservation and function.

Final Recommendation & Action Plan

The E. coli-expressed Stefin-1 with a small His-tag has a moderate to high probability of correct folding due to the protein's small size and lack of complex modifications, but experimental validation is crucial. Begin with Application 4 (Structural Characterization) to assess folding quality through CD spectroscopy and validate inhibitory activity using standard protease inhibition assays (e.g., against cathepsins). Applications 1, 2, and 5 require rigorous functional validation before proceeding. Application 3 (antibody development) can proceed immediately. For reliable Stefin-1 research, confirm inhibitory activity and consider using refolding protocols if initial validation indicates poor functionality.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is an intracellular thiol proteinase inhibitor.
Subcellular Location
Cytoplasm.
Protein Families
Cystatin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*