Recombinant Mouse Stromal interaction molecule 1 (Stim1)

Code CSB-YP022829MO
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP022829MO
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP022829MO-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP022829MO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP022829MO
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Stim1; Sim; Stromal interaction molecule 1
Species
Mus musculus (Mouse)
Expression Region
23-213
Target Protein Sequence
LSHSHSEKNTGASSGATSEESTEAEFCRIDKPLCHSEDEKLSFEAVRNIHKLMDDDANGD VDVEESDEFLREDLNYHDPTVKHSTFHGEDKLISVEDLWKAWKSSEVYNWTVDEVIQWLI TYVELPQYEETFRKLQLTGHAMPRLAVTNTTMTGTVLKMTDRSHRQKLQLKALDTVLFGP PLLTRHNHLKD
Protein Length
Extracellular domain
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in mediating store-operated Ca(2+) entry (SOCE), a Ca(2+) influx following depletion of intracellular Ca(2+) stores. Acts as Ca(2+) sensor in the endoplasmic reticulum via its EF-hand domain. Upon Ca(2+) depletion, translocates from the endoplasmic reticulum to the plasma membrane where it activates the Ca(2+) release-activated Ca(2+) (CRAC) channel subunit ORAI1. Involved in enamel formation. Activated following interaction with STIMATE, leading to promote STIM1 conformational switch.
Gene References into Functions
  1. STIM1 and TRPV4 act as mechanical transduction channels for osteoclasts during the early and late differentiation stages, respectively. PMID: 29604963
  2. STIM1 knockout enhances PDGFR-PLCgamma-STIM2 signaling, which in turn increases PDGF-BB-induced Ca2+ elevation. PMID: 29912163
  3. Expression of a constitutively active STIM1 mutant, which no longer binds UNC93B1, restores antigen degradation and cross-presentation in 3d-mutated dendritic cells. PMID: 29158474
  4. Stim1 promotes cross-presentation of phagocytosed antigens in dendritic cells.Stim1 role in Calcium signaling.Stim1 is dispensable for dendritic cells maturation and phagocytosis. PMID: 29176619
  5. SOCE was largely diminished in cells where STIM1 and/or ORAI1 had been silenced by small interfering (si)RNA. We conclude that extracellular ATP activates SOCE in white adipocytes, an effect predominantly mediated by STIM1 and ORAI1. PMID: 29335300
  6. Study shows that STIM1 and ORAI1 promotes membrane ruffling by showing that phospho-STIM1 localizes at the leading edge of cells, and that both phospho-STIM1 and ORAI1 co-localize with cortactin. PMID: 28341841
  7. Here, the authors show that hepatocytes from obese mice displayed significantly diminished store-operated Ca(2+) entry as a result of impaired STIM1 translocation, which was associated with aberrant STIM1 O-GlycNAcylation. PMID: 29243589
  8. STIM1 plays an important role in paraquat induced cell cycle arrest and cell death in acute lung injury. PMID: 29709426
  9. Silencing of beta 1 integrin gene regulates the gene expression of storeoperated Ca2+ entry (SOCE)-associated genes (STIM1, ORAI1 and TRPC1). PMID: 28656279
  10. Stim1 and Stim2 deficient B cells show an accelerated pace of affinity maturation but do not have dramatically impaired antibody production to T-independent antigen immunization PMID: 27572320
  11. STIM1 deletion protects the liver from ischemia/reperfusion injury in mice through inhibiting inflammation, oxidative stress and apoptosis. PMID: 29305862
  12. These results highlight how STIM1-dependent Ca(2+) microdomains have a major impact on intracellular Ca(2+) homeostasis, cytoskeletal remodeling and cellular signaling, even when excitation-contraction coupling is present. PMID: 27150728
  13. hearts of STIM1 haploinsufficient mice had a superficial resemblance to the WT phenotype under stress-free conditions; however, STIM1 haploinsufficient mice showed a maladaptive response to cardiac pressure overload PMID: 29145451
  14. Cultured hippocampal neurons expressing mutant PS1 had attenuated CCE that was associated with destabilized dendritic spines, which were rescued by either gamma-secretase inhibition or overexpression of STIM1. PMID: 27601731
  15. Loss-of-function mutations in the Ca(2+) release-activated Ca(2+) channel genes ORAI1 and STIM1 abolish store-operated Ca(2+) entry (SOCE) and result in ectodermal dysplasia with amelogenesis imperfecta. SOCE is essential for proper enamel mineralization, in which Stim1 plays a critical role during the maturation process. PMID: 28732182
  16. Reactive oxygen species (ROS) production, degranulation, and phagocytosis are normal in the absence of STIM2, suggesting STIM1 is the dominant calcium sensor required for classical short-term neutrophil responses PMID: 28724541
  17. Stromal interaction molecule 1 (STIM1), which regulates the refilling of ER Ca(2+), has been investigated in several systems including the CNS. In addition to a previous study showing that STIM1 regulates dendritic ER Ca(2+) refilling and mGluR1-mediated synaptic transmission, we provide compelling evidence describing a novel role of STIM1 in spike firing Purkinje neurons. PMID: 28821659
  18. data indicate that STIM1 overexpression in neurons in the brain perturbs metabotropic glutamate receptor signaling, leading to impairments in long-term depression and alterations in animal behavior PMID: 27913207
  19. Ca(2+) entry serves critical cellular functions in virtually every cell type, and appropriate regulation of Ca(2+) in neurons is essential for proper function. PMID: 28258168
  20. STIM1-induced Ca(2+) signaling activates Pyk2 to inhibit the interaction of VE-PTP and VE-cadherin and hence increase endothelial permeability. PMID: 28385807
  21. suggests that STIM1 is a multifunctional signaling effector that participates in the control of membrane excitability and Ca(2+) signaling events in beta-cells PMID: 28003364
  22. vascular smooth muscle STIM1 plays a crucial role in the development of hypertension and associated cardiovascular pathologies. PMID: 27470514
  23. Data show that the STIM1 Ksp (Eg5)-cre knockout mice produced more urine compared to control. PMID: 27336410
  24. We conclude that STIM1 has an unexpected function in the heart where it alters communication between the sarcolemma and sarcoplasmic reticulum resulting in greater Ca(2+) flux and a leaky SR compartment. PMID: 26241845
  25. Stim1 silencing prevented mTOR complex 2 phosphorylation of Akt(S473) via a direct interaction between STIM1 and Rictor. This represses GSK-3beta activity and prevents/reverses cardiac hypertrophy. PMID: 26936863
  26. role of STIM1, Orai1 and TRPCs, and thus SOCE, in thrombus formation, suggests that therapies directed against SOCE and targeting these molecules during cardiovascular and cerebrovascular events could improve traditional anti-thrombotic treatments PMID: 27161229
  27. Quantitative Proteomics Reveals the Essential Roles of Stromal Interaction Molecule 1 (STIM1) in the Testicular Cord Formation in Mouse Testis PMID: 26199344
  28. Results show the cytoplasmic domain of STIM1 as a target for calpains which cleave STIM1 to control its cellular abundance. Furthermore, STIM1's susceptibility to calpain cleavage leads to enhanced STIM1 degradation during the progression of apoptosis. PMID: 26454179
  29. Orai1 and STIM1 have roles in inhibiting matrix protein expression PMID: 25788524
  30. STIM1 plays opposing roles in vascular smooth muscle vs. endothelial cells in the regulation of vascular reactivity. PMID: 24965067
  31. STIM1 is a multifunctional regulator of Ca(2+) dynamics in SANCs that links SR Ca(2+) store content with electrical events occurring in the plasma membrane, thereby contributing to automaticity of the SAN PMID: 26424448
  32. STIM1L does not mediate rapid store-operated Ca(2+) entry but can trap and gate Orai1 channels efficiently without remodeling cortical ER cisternae. PMID: 25736291
  33. STIM1 is a key regulator of mGluR1-dependent Ca(2+) signaling. PMID: 25304289
  34. SOCE blockers or ablation of STIM1, STIM2, or Orai1 severely impaired nucleotide-induced migration and phagocytosis in microglia. PMID: 25471906
  35. Using an imiquimod-induced psoriasis-like skin model, we show that KO mice had less neutrophil infiltration in the epidermis than controls, whereas neither chemoattractant production in the epidermis nor macrophage migration was decreased. PMID: 25837581
  36. Chronically Mtb-infected, STIM1-deficient mice had reduced levels of inducible regulatory T cells (iTregs) due to a T cell-intrinsic requirement for STIM1 in iTreg differentiation and excessive production of IFN-gamma and IL-12 PMID: 25938788
  37. Data show that increased activity of STIM1-Orai1 complex inducing enhanced Ca(2+) influx is a disease determinant in muscular dystrophy. PMID: 24556214
  38. STIM1, STIM2, and CRAC channel function play distinct but synergistic roles in CD4+ and CD8+ T cells during antiviral immunity PMID: 25157823
  39. Data indicate that STIM1 is involved in both early neural differentiation of ES cells and survival of early differentiated ES cells independent of Orai1-mediated SOCE. PMID: 24424349
  40. STIM1 binds to SERCA1 via 449 to 671 aa region. PMID: 24077737
  41. Store-operated Ca(2+) entry was lost in embryonic and adult mouse neural progenitor cells from transgenic mice lacking Stim1. PMID: 24990931
  42. this study presents a structural model of the Ca(2+)-unbound EF-SAM domain of STIM1 that is consistent with a wide range of evidence, including resistance to proteolytic cleavage of the putative dimerization portion. PMID: 24650897
  43. data demonstrate that stromal interaction molecule 1 plays an essential role in normal cardiac function in the adult heart, which may be important for the regulation of endoplasmic reticulum and mitochondrial function PMID: 24585777
  44. In vivo the loss of store-operated calcium entry in stim1(-/-) chimeric mice results in marked susceptibility to bacterial infections but also protection from tissue injury in hepatic ischemia/reperfusion injury. PMID: 24493668
  45. a direct correlation between ER morphology and SOCE and highlight the importance of RTN4 in cellular Ca(2+) homeostasis PMID: 24558039
  46. Using mice lacking STIM1 and its homologue STIM2, authors find that store-operated calcium entry in CD8(+) T cells is required to prevent the engraftment of melanoma and colon carcinoma cells and to control tumour growth. PMID: 23922331
  47. Dimerization of STIM1 endoplasmic reticulum domains causes an extensive conformational change in cytoplasmic domains, allowing extension of the cytoplasmic domain across the gap between ER and plasma membrane and communication with ORAI channels. PMID: 23851458
  48. inhibition of the SOCE downstream target CaM kinase kinase beta (CaMKKbeta) or knockdown of AMPKalpha1 suppressed PAR-1-mediated phosphorylation of p38beta and hence STIM1. PMID: 23625915
  49. STIM1 and STIM2-mediated store-operated Ca2+ influx, leading to efficient activation of NFAT (nuclear factor of activated T cells), is critical for the postselection maturation of agonist-selected T cells. PMID: 23499491
  50. these findings suggest that a positive feedback control between STIM1/SOCE and NFATc3 is required for efficient induction and progression of myoblast differentiation. PMID: 23206701

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein. Sarcoplasmic reticulum. Cytoplasm, cytoskeleton.
Tissue Specificity
Expressed in maturation-stage ameloblasts (at protein level). Expressed in all tissues examined and in many cell types, including bone marrow stroma, fibroblast, B-cell precursors, lymphoma and erythroleukemia.
Database Links

KEGG: mmu:20866

STRING: 10090.ENSMUSP00000033289

UniGene: Mm.645

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1