Recombinant Mouse Survival motor neuron protein (Smn1)

In Stock
Code CSB-MP021838MO
Abbreviation Recombinant Mouse Smn1 protein
MSDS
Size $500
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
Smn1; Smn; Survival motor neuron protein
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
1-288aa
Target Protein Sequence
MAMGSGGAGSEQEDTVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETPDKPKGTARRKPAKKNKSQKKNATTPLKQWKVGDKCSAVWSEDGCIYPATITSIDFKRETCVVVYTGYGNREEQNLSDLLSPTCEVANSTEQNTQENESQVSTDDSEHSSRSLRSKAHSKSKAAPWTSFLPPPPPMPGSGLGPGKPGLKFNGPPPPPPLPPPPFLPCWMPPFPSGPPIIPPPPPISPDCLDDTDALGSMLISWYMSGYHTGYYMGFRQNKKEGKCSHTN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.3kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Survival motor neuron protein (Smn1) is produced using a mammalian cell expression system, which appears to ensure proper eukaryotic post-translational modifications and functionality. This full-length protein spans amino acids 1-288 and includes an N-terminal 10xHis tag plus a C-terminal Myc tag for purification and detection purposes. SDS-PAGE analysis indicates the protein reaches purity levels exceeding 85%, which should make it suitable for various research applications.

The survival motor neuron protein (Smn1) seems to play a critical role in assembling small nuclear ribonucleoproteins (snRNPs) - key components of the spliceosome complex. It participates in pre-mRNA splicing, a fundamental process in gene expression. Smn1's function is likely vital for cellular RNA processing and has become a focal point for understanding molecular mechanisms of RNA metabolism and related cellular pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The dual tagging system - that N-terminal 10xHis tag paired with the C-terminal Myc tag - allows for efficient purification and detection of Smn1 protein complexes. Researchers can immobilize this dual-tagged recombinant Smn1 on nickel-affinity resins to capture interacting proteins from mouse tissue lysates or cell extracts. The Myc tag then provides a way to specifically detect and confirm Smn1 presence in pulled-down complexes using anti-Myc antibodies. This approach may prove particularly valuable for identifying novel binding partners of the survival motor neuron protein in motor neuron biology research.

2. Antibody Development and Validation

This full-length recombinant mouse Smn1 protein could serve as an ideal antigen for generating specific antibodies against the survival motor neuron protein. The mammalian expression system likely ensures proper protein folding and post-translational modifications that closely resemble the native protein. Researchers might use this protein to immunize animals for polyclonal antibody production or as a screening antigen for monoclonal antibody development. Those dual tags also offer a way to validate antibody specificity through tag-based detection controls.

3. Biochemical Characterization and Stability Studies

This purified recombinant Smn1 protein enables detailed biochemical analysis - think protein stability assessments, folding property studies, and buffer optimization experiments. Thermal stability assays, pH tolerance tests, and storage condition optimization all become possible with this full-length protein. The 85% purity level appears sufficient for most biochemical characterization experiments, allowing researchers to investigate how the protein behaves under various experimental conditions relevant to motor neuron research.

4. ELISA-Based Quantitative Assays

The dual-tagged Smn1 protein may serve as a standard or control in enzyme-linked immunosorbent assays for quantifying Smn1 levels in biological samples. Both Myc and His tags provide multiple detection options, which could enable sandwich ELISA formats or direct detection methods. This application might prove particularly useful for researchers studying Smn1 expression levels across different mouse tissues, developmental stages, or disease models where quantitative measurement of the survival motor neuron protein is required.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The SMN complex catalyzes the assembly of small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome, and thereby plays an important role in the splicing of cellular pre-mRNAs. Most spliceosomal snRNPs contain a common set of Sm proteins SNRPB, SNRPD1, SNRPD2, SNRPD3, SNRPE, SNRPF and SNRPG that assemble in a heptameric protein ring on the Sm site of the small nuclear RNA to form the core snRNP (Sm core). In the cytosol, the Sm proteins SNRPD1, SNRPD2, SNRPE, SNRPF and SNRPG are trapped in an inactive 6S pICln-Sm complex by the chaperone CLNS1A that controls the assembly of the core snRNP. To assemble core snRNPs, the SMN complex accepts the trapped 5Sm proteins from CLNS1A forming an intermediate. Binding of snRNA inside 5Sm ultimately triggers eviction of the SMN complex, thereby allowing binding of SNRPD3 and SNRPB to complete assembly of the core snRNP. Within the SMN complex, SMN1 acts as a structural backbone and together with GEMIN2 it gathers the Sm complex subunits. Ensures the correct splicing of U12 intron-containing genes that may be important for normal motor and proprioceptive neurons development. Also required for resolving RNA-DNA hybrids created by RNA polymerase II, that form R-loop in transcription terminal regions, an important step in proper transcription termination. May also play a role in the metabolism of small nucleolar ribonucleoprotein (snoRNPs).
Gene References into Functions
  1. Survival Motor Neuron (SMN) protein is required for normal mouse liver development PMID: 27698380
  2. Widespread intron retention, particularly of minor U12 introns, in the spinal cord of mice 30 d after SMA induction. PMID: 28270613
  3. A proteomic profile of embryonic stem cells with low smn protein revealed thematic changes consistent with the developmental dysfunction seen in the pathophysiological development of patients with spinal muscular atrophy. Pathways associated with mRNA spicing, protein translation, post-translational modification and perhaps most striking, mitochondrial function and specifically mitochondrial dysfunction were highlighted. PMID: 27145767
  4. Loganin is capable of increas-ing the SMN protein level under SMN-deficient conditions both inin vitro and in vivo models of spinal muscular atrophy via Akt/mTOR pathway. PMID: 27241020
  5. miR-431 expression was highly increased, and a number of its putative mRNA targets were significantly downregulated in motor neurons after SMN loss. Further, we found that miR-431 regulates motor neuron neurite length by targeting several molecules previously identified to play a role in motor neuron axon outgrowth, including chondrolectin PMID: 27005422
  6. To determine the dependence of oligodendrocyte (OL)on the Smn protein(SMN1), we utilized the Smn-/-;SMN2 (severe) mouse model. Our data suggest that despite the multi-functionality and ubiquitous expression of the Smn protein, it does not play a key role in myelination of the CNS, at least in the context of spinal muscular atrophy pathogenesis. PMID: 28069797
  7. our studies show that this G-motif represents a novel and essential determinant for axonal localization of the Anxa2 mRNA mediated by the SMN complex. PMID: 28258160
  8. A long non-coding RNA (lncRNA) that arises from the antisense strand of SMN, SMN-AS1, is enriched in neurons and transcriptionally represses SMN expression by recruiting the epigenetic Polycomb repressive complex-2. PMID: 28017471
  9. SMN1 expression restoration is curative in a spinal muscular atrophy model mice. PMID: 27907033
  10. Survival motor neuron 1, and survival motor neuron 2, depletion results in increased alternative splicing events. PMID: 27736905
  11. these results demonstrate that SMN deficiency impacts spleen development and suggests a potential role for immunological development in Spinal muscular atrophy. PMID: 28062667
  12. Itch monoubiquitinates SMN and monoubiquitination of SMN plays an important role in regulating its cellular localization. PMID: 26908624
  13. muscle does not appear to require high levels of SMN above what is produced by two copies of SMN2 PMID: 26276812
  14. Findings demonstrate that high expression of SMN in the motor neuron is both necessary and sufficient for proper function of the motor unit. In addition, SMN high expression in neurons and glia has a major impact on survival. PMID: 26206889
  15. This study identifies pathways related to the function of Smn and associated with differential motor unit vulnerability, thus presenting a number of exciting targets for future therapeutic development. PMID: 26374403
  16. Smn complex deficiency caused constipation, delayed gastric emptying, slow intestinal transit and reduced colonic motility. PMID: 25859009
  17. Primary cell culture and two different SMA model mice to demonstrate that reduced levels of Smn lead to a profound disruption in the expression of myogenic genes. PMID: 24691550
  18. Results suggest that SMN plays a role in the maintenance of pluripotent embryonic stem cells and neuronal differentiation in mice. PMID: 24633826
  19. AAV9-mediated SMN gene therapy elicits cure for spinal muscular atrophy. PMID: 25358252
  20. Data show that changes in U12 introns-dependent splicing become apparent after prolonged/extensive survival motor neuron proteins SMN depletion. PMID: 25692239
  21. This work both reveals a new autoregulatory pathway governing SMN expression, and identifies a new mechanism through which SMN can modulate specific mRNA expression via Gemin5. PMID: 25911097
  22. SMN is involved in the axonal translocation of hnRNP R and hnRNP R-bound RNA/protein complexes. PMID: 25338097
  23. Findings are consistent with a role for SMN in myotube formation through effects on muscle differentiation and cell motility. PMID: 24760765
  24. Data indicate that Smn deficiency affects the subcellular transcriptome in both the somatodendritic and axonal regions of motoneurons impairing transcripts with selected functions. PMID: 25246652
  25. Findings suggest that carriers of SMN1 mutations and/or deletions may be at an increased risk of developing pancreatic and glucose metabolism defects. PMID: 24497575
  26. Data support a role for SMN in the regulation of mRNA localization and axonal transport through its interaction with mRNA-binding proteins such as IMP1 PMID: 23897586
  27. It improves neuromuscular function and motor neuron survival in mutant SOD1 mice. PMID: 24210254
  28. SMN1 is essential for U7 biogenesis and histone mRNA processing. PMID: 24332368
  29. sregulation of UBA1 and subsequent ubiquitination pathways led to beta-catenin accumulation in a model of mutant SMN spinal muscular atrophy. PMID: 24590288
  30. Restoration of SMN to Emx-1 expressing cortical neurons is not sufficient to provide benefit to a severe mouse model of Spinal Muscular Atrophy. PMID: 23512182
  31. enhanced Survival Motoneuron protein has a role in neuromuscular junction maturation PMID: 24463453
  32. a new mechanism for regulating SMN levels and provides new insight into the roles of U1A in 3' processing of mRNAs. PMID: 24362020
  33. Study shows that neuronal aggregates formed by mutant FUS protein may aberrantly sequester survival motor neuron protein and concomitantly cause a reduction of SMN levels in the axon, leading to axonal defects. PMID: 23681068
  34. Smn protein reduction causes an increment of the autophagosome number as well as of the autophagy-related proteins Beclin1 and LC3-II. PMID: 23788043
  35. Low SMN levels might result in localization deficiencies of mRNAs required for axonogenesis. PMID: 24152552
  36. SAHA significantly increases SMN levels and also increased vascular density in SMA mice (P<0.05), suggesting that the vascular defect in SMA mice is amenable to SAHA treatment. PMID: 23583590
  37. Overexpressing the SMN protein in mutant SOD1 mice, a model of familial ALS, alleviates this phenomenon, most likely in a cell-autonomous manner, and significantly mitigates the loss of motor neurons in the spinal cord and in culture dishes. PMID: 22581780
  38. Expressing SMN pan-neuronally in a mouse model of severe spinal muscular atrophy results in a four-fold increase in survival. PMID: 23029491
  39. Data suggest a critical role of aurvival of motor neuron SMN1 and SMN2 proteins in the intrinsic regulation of muscle differentiation and suggest that abnormal muscle development contributes to the manifestation of spinal muscular atrophy (SMA) symptoms. PMID: 22705478
  40. SMN plays distinct roles in muscle, neuromuscular junctions, and motor neuron somal synapses PMID: 22723710
  41. This study identified a critical threshold of Smn that dictates onset of SMA in the intermediate Smn(2B/-) mouse model. PMID: 22071333
  42. Hyper-phosphorylation of profilin2a is the molecular link between SMN and the ROCK pathway repressing neurite outgrowth in neuronal cells. PMID: 21920940
  43. SMN is essential for the normal postnatal maturation of motor nerve terminals. PMID: 22022549
  44. comparison of systemic versus CNS restoration of SMN in a severe mouse model PMID: 21979052
  45. This study demonistrated that the spinal muscular atrophy mouse model, SMADelta7, displays altered axonal transport without global neurofilament alterations PMID: 21681521
  46. Prolactin increases SMN expression and survival in a mouse model of severe spinal muscular atrophy via the STAT5 pathway PMID: 21785216
  47. even in severe SMA, timely reinstatement of the SMN protein may halt the progression of the disease PMID: 21785219
  48. Data show that SMN and HuD form a complex in spinal motor axons, and that both interact with cpg15 mRNA in neurons. PMID: 21652774
  49. Involvement of SMN in formation of stress granules may play an important role in cell survival. PMID: 21234798
  50. Mouse survival motor neuron alleles that mimic SMN2 splicing and are inducible rescue embryonic lethality early in development but not late [SMN2] PMID: 21249120

Show More

Hide All

Subcellular Location
Nucleus, gem. Nucleus, Cajal body. Cytoplasm. Cytoplasmic granule. Perikaryon. Cell projection, neuron projection. Cell projection, axon. Cytoplasm, myofibril, sarcomere, Z line.
Protein Families
SMN family
Tissue Specificity
Expressed in motor neurons.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*