Recombinant Mouse Synaptonemal complex protein 3(Sycp3)

Code CSB-YP022993MO
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP022993MO
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP022993MO-B
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP022993MO
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP022993MO
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity >85% (SDS-PAGE)
Target Names Sycp3
Uniprot No. P70281
Alternative Names Sycp3; Scp3; Synaptonemal complex protein 3; SCP-3
Species Mus musculus (Mouse)
Expression Region 1-254
Target Protein Sequence MLRGCGDSDSSPEPLSKHLKMVPGGRKHSGKSGKPPLVDQPKKAFDFEKDDKDLSGSEED VADEKAPVIDKHGKKRSAGIIEDVGGEVQNMLEKFGADINKALLAKRKRIEMYTKASFKA SNQKIEQIWKTQQEEIQKLNNEYSQQFMNVLQQWELDIQKFEEQGEKLSNLFRQQQKIFQ QSRIVQSQRMFAMKQIHEQFIKSLEDVEKNNDNLFTGTQSELKKEMAMLQKKVMMETQQQ EMANVRKSLQSMLF
Protein Length Full length protein
Tag Info The following tags are available.
N-terminal His-tagged
Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form Lyophilized powder
Buffer before Lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Component of the synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase
Gene References into Functions
  1. Unlike other vertebrates, rat and mouse SYCP3 exists in 2 isoforms; the short isoform is conserved in vertebrates and the longer isoform, appeared 15 million years ago in a common ancestor of rat and mouse and after separation from the hamster branch. PMID: 20339291
  2. X-linked lymphocyte-regulated protein pM1 (XMR), XLR, and SCP3 render tumor cells resistant to antitumor immunity PMID: 20395201
  3. absence of synaptonemal complex protein 3 (SCP3) promotes aneuploidy in murine oocytes by inducing defective meiotic chromosome segregation PMID: 12004129
  4. In Scp3-deficient (knockout) mice, spermatogenesis and testicular degeneration are augmented when E2F1 is also deficient. PMID: 14685160
  5. Rad21, and the superimposed SCP3 and SCP2, are involved in the monopolar attachment of sister kinetochores during meiosis I PMID: 14970259
  6. SYCP2 and SYCP3 proteins function in the specificity of chromatin attachment to the chromosome core PMID: 15237206
  7. SYCP3 has a temporally restricted role in maintaining, but not establishing, cohesin-core organization during prophase I. PMID: 15870106
  8. The SYCP3 is expressed in germ cell-like cells. The nuclear distribution of SYCP3 in the germ cell-like cells is highly abnormal and not associated with the chromosomes of these cells. PMID: 16644921
  9. DNA double-stranded breaks are inefficiently repaired in Sycp3(-)(/)(-) oocytes, thereby generating a temporal spectrum of recombination errors. T PMID: 16717125
  10. Sycp3 is a biologically relevant target of Dazl-mediated translation in mammals. PMID: 17526644

Show More

Hide All

Subcellular Location Nucleus, Chromosome, Chromosome, centromere
Protein Families XLR/SYCP3 family
Tissue Specificity Detected in oocytes (PubMed:16717126). Detected in spermatocytes and testis (at protein level) (PubMed:10678170, PubMed:16717126, PubMed:22761579).
Database Links

KEGG: mmu:20962

STRING: 10090.ENSMUSP00000020252

UniGene: Mm.297977

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1