Recombinant Mouse T-cell leukemia/lymphoma protein 1A (Tcl1a)

Code CSB-YP023313MO
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP023313MO-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP023313MO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP023313MO
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Tcl1a; Tcl1; T-cell leukemia/lymphoma protein 1A; Oncogene TCL-1; Oncogene TCL1; Protein p14 TCL1
Species
Mus musculus (Mouse)
Expression Region
1-116
Target Protein Sequence
MATQRAHRAETPAHPNRLWIWEKHVYLDEFRRSWLPVVIKSNEKFQVILRQEDVTLGEAM SPSQLVPYELPLMWQLYPKDRYRSCDSMYWQILYHIKFRDVEDMLLELIDSESNDE
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Enhances the phosphorylation and activation of AKT1 and AKT2. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival.
Gene References into Functions
  1. acalabrutinib showed increased BTK selectivity compared with ibrutinib while demonstrating significant antitumor efficacy in vivo on par with ibrutinib. Similarly, in the TCL1 adoptive transfer model, decreased phosphorylation of BTK, PLCgamma2, and S6 was observed. Most notably, treatment with acalabrutinib resulted in a significant increase in survival compared with mice receiving vehicle PMID: 27903679
  2. suggests that in the TCL1-tg mouse, main tumor support may not be derived from CD4+ T cells, but from the monocytic population PMID: 26522084
  3. we revealed that one of the key functions of KLF4-induced TCL1 during reprogramming is to promote the metabolic shift from oxidative phosphorylation to glycolysis. PMID: 28262547
  4. results indicate that decreased Cav-1 in Emu-TCL1 mice significantly delays the onset of CLL and decreases leukemic progression by inhibiting MAPK-Erk signaling, suggesting a role for Cav-1 in the proliferation and progression of CLL PMID: 26435347
  5. This review discusses the main features of the original TCL1 models and the different lines of research successively developed with particular attention to genetically compound mice and the therapeutic applications in drug development. PMID: 25700368
  6. Tcl1 expression downregulated a distinct group of genes, including Ndp52, whose expression is very high in blastocysts but reduced in the primitive ectoderm. PMID: 23940776
  7. Data indicate that APRIL expression accelerates the onset of TCL1-driven leukemia formation mainly through TACI activation. PMID: 24100449
  8. These findings demonstrate cooperation of Tcl1 and the NF-kB pathway in the pathogenesis of aggressive chronic lymphocytic leukemia. PMID: 23591791
  9. An important role of TCL1 in activating the ER stress response in support for malignant progression of chronic lymphocytic leukemia. PMID: 22692508
  10. TCL1 and/or other genes in the TCL1 pathway are responsible for the initiation of human chronic lymphocytic leukemia. PMID: 12011454
  11. role in early embryonic development and overexpression in human seminomas PMID: 12181493
  12. Akt kinase activity can be inhibited by a peptide spanning the betaA strand of the proto-oncogene TCL1 PMID: 15459205
  13. Tcl1 is a coactivator of Akt signaling, in normal T- and B-cell development and function. PMID: 15479728
  14. Detailed mechanism for TCL1-augmented signaling helps explain the delayed occurrence of mature T cell expansions and leukemias despite tumorigenic TCL1 dysregulation that begins in early thymocytes. PMID: 16002684
  15. findings indicate that other oncogenic mechanism(s) may be involved in the development of solid tumors in Emu-TCL1 transgenic mice PMID: 16424025
  16. TCL1 transgenic B cells primed for transformation must experience the germinal center environment and, for at least some, develop genome instability to become fully malignant. PMID: 16728701
  17. Data indicate that the immunoglobulin heavy and light chain rearrangements in TCL1 mice display minimal levels of somatic mutations and exhibit several molecular features found in the human disease. PMID: 16864779
  18. early mouse embryos display a physiological dissociation between TCL1 functions of AKT phosphorylation and phosphorylated AKT transfer to nucleus PMID: 17901877
  19. a ternary complex of TCL1, Epac1, and Akt forms in activated macrophages both promoting Akt activation and regulating intracellular distribution of Akt PMID: 17993260
  20. Tcl1 gene(s) might have important roles in hair formation, by its involvement in cycling and self-renewal of transient amplifying (TA) and stem-cell (SC) populations. PMID: 19169282
  21. infusion of chronic lymphocytic leukemia cells into young Emu-TCL1 mice induced defects comparable to those seen in mice with developed leukemia, demonstrating a causal relationship between leukemia and the T-cell defects PMID: 19332800

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Microsome. Endoplasmic reticulum.
Protein Families
TCL1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1