Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Pde5a; Pde5; cGMP-specific 3',5'-cyclic phosphodiesterase; EC 3.1.4.35; cGMP-binding cGMP-specific phosphodiesterase; CGB-PDE
Species
Mus musculus (Mouse)
Expression Region
154-320aa
Target Protein Sequence
DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Unleash the potential of your cancer research with our Recombinant Mouse Pde5a, also known as cGMP-specific 3',5'-cyclic phosphodiesterase. This protein, recombinantly produced in E.coli, stands as a pivotal tool for exploring the multifaceted mechanisms of cancer biology.
With a partial length (154-320aa), this product comes with a dual tag - N-terminal 10xHis-tag and C-terminal Myc-tag, ensuring streamlined purification and enhanced stability. Our Pde5a maintains a stringent purity standard of greater than 90% as determined by SDS-PAGE. Select the liquid form for immediate experimentation, or the lyophilized powder for extended stability and convenience, and propel your research to new heights.
