Recombinant Mouse cGMP-specific 3,5-cyclic phosphodiesterase (Pde5a), partial

In Stock Promotion
Code CSB-EP807017MO
Abbreviation Recombinant Mouse Pde5a protein, partial
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP807017MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pde5a.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP807017MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pde5a.
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Pde5a; Pde5; cGMP-specific 3',5'-cyclic phosphodiesterase; EC 3.1.4.35; cGMP-binding cGMP-specific phosphodiesterase; CGB-PDE
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
154-320aa
Target Protein Sequence
DVTALCHKIFLHIHGLISADRYSLFLVCEDSSKDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.1 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Unleash the potential of your cancer research with our Recombinant Mouse Pde5a, also known as cGMP-specific 3',5'-cyclic phosphodiesterase. This protein, recombinantly produced in E.coli, stands as a pivotal tool for exploring the multifaceted mechanisms of cancer biology.

With a partial length (154-320aa), this product comes with a dual tag - N-terminal 10xHis-tag and C-terminal Myc-tag, ensuring streamlined purification and enhanced stability. Our Pde5a maintains a stringent purity standard of greater than 90% as determined by SDS-PAGE. Select the liquid form for immediate experimentation, or the lyophilized powder for extended stability and convenience, and propel your research to new heights.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'-GMP. Specifically regulates nitric-oxide-generated cGMP.
Gene References into Functions
  1. analysis of the mechanisms involved revealed the induction of bone morphogenetic protein-7 (BMP7) expression, a critical regulator of angiogenesis and kidney homeostasis, through a PDE5i-dependent downregulation of miR-22. In conclusion PDE5i slows the progression of Diabetic Nephropathy (DN) in mice, improving hemodynamic parameters and vessel integrity. PMID: 28294194
  2. the activation of PDE5 is among the mechanisms contributing to the cGMP decrease, these results suggest that another cGMP phosphodiesterase is also activated by LH signaling. PMID: 29341896
  3. Report expression of Pde5a1/2/3 in cardiac myocytes and suggest role in induction of cardiac hypertrophy. PMID: 28247930
  4. Upon S-nitrosylation, PDE5 exhibits reduced activity and degradation via the ubiquitin-proteasome system. PMID: 26093192
  5. Short-term hemolysis is sufficient to establish a priapism phenotype and results in loss of erectile function. PDE5I treatment ameliorates priapism, in part, because of restored NO balance with decreased ROS generation and increased PDE5 activity. PMID: 26346631
  6. Inhibition of type 5 phosphodiesterase counteracts beta2-adrenergic signalling in beating cardiomyocytes. PMID: 25852085
  7. Addition of sildenafil, a phosphodiesterase 5 (PDE5) inhibitor, in the drinking water had a small effect in reducing myocyte hypertrophy in wild type mice and no effect in betaRM mice. PMID: 25139994
  8. findings reveal that excess adenosine-mediated ADORA2B signaling underlies reduced penile PDE activity by decreasing PDE5 gene expression in a HIF-1alpha-dependent manner PMID: 24614760
  9. Phosphodiesterase 5 attenuates the vasodilatory response in renovascular hypertension. PMID: 24260450
  10. Findings suggest that continuous, long-term treatment with PDE5 inhibitors reverses eNOS uncoupling in the sickle cell penis which restores endothelial NO synthesis. PMID: 23844149
  11. Data indicate that the phosphodiesterase 5 (PDE5) expression is equal in the splenocytes from both genders, but splenocytes from female mice possess higher basal level of cGMP compared to the male ones. PMID: 23911424
  12. Myocardial PDE5 expression is increased in the hearts of humans and mice with chronic pressure overload. PMID: 23527037
  13. Sildenafil-mediated PDE5 inhibition significantly reduces diaphragm respiratory muscle dysfunction and pathology in the mdx mouse model of Duchenne muscular dystrophy. PMID: 22653783
  14. these data strongly support a primary role of myocyte PDE5 regulation to myocardial pathobiology PMID: 20970280
  15. PDE5-inhibition blocks TRPC6 channel activation and associated Cn/NFAT activation signaling by PKG-dependent channel phosphorylation PMID: 19961855
  16. PDE5 inhibition enhances ischemia-induced angiogenesis with mobilization of endothelial progenitor cells through a protein kinase G-dependent HIF-1/vascular endothelial growth factor pathway. PMID: 20413734
  17. phosphorylation and functional suppression of TRPC6 underlie prevention of pathological hypertrophy by PDE5 inhibition. PMID: 20177073
  18. Myocardial oxidative stress increases PDE5 expression in the failing heart PMID: 20308615
  19. Data show that recombinant cyclic GMP-binding phosphodiesterase 5 (PDE5) is activated directly upon cGMP binding to the GAF A domain, and this effect does not require PDE5 phosphorylation. PMID: 12554648
  20. PDE5A has a novel regulatory role in hearts under adrenergic stimulation. PDE5A catabolic regulation is specific coupled with NOS3-derived cGMP attributable to protein subcellular localization and targeted synthetic/catabolic coupling. PMID: 15576651
  21. findings show a much greater role of PDE5A in hearts subjected to sustained pressure load and that PDE5A inhibition in this setting prevents and reverses cardiac chamber, cellular and molecular remodeling induced by this stimulus PMID: 15665834
  22. sildenafil inhibits PDE5 and preconditions adult cardiac myocytes against necrosis and apoptosis PMID: 15668244
  23. Priapism causes dysregulated PDE5A expression/activity suggesting that PDE5A dysregulation is a fundamental mechanism for priapism. PMID: 15668387
  24. Regulation of cardiac beta-adrenergic response by cGMP is specifically linked to a nitric oxide-synthesis/PDE-5-hydrolyzed pool signaling via protein kinase G. PMID: 17420342
  25. Inhibition by sildenafil ameliorates right ventricular hypertrophy and pulmonary fibrosis caused by intratracheal bleomycin. PMID: 17965319
  26. Upregulating the NO/cGMP pathway by PDE-5 inhibition during hypoxia reduces neuron apoptosis, regardless of HIF-1alpha, through an interaction involving ERK1/2 and p38. PMID: 18641057
  27. sildenafil activates a PKG-dependent novel signaling cascade that involves activation of ERK and inhibition of glycogen synthase kinase 3beta leading to cytoprotection PMID: 18723505
  28. Ten weeks after myocardial infarction, left ventricular end-systolic and end-diastolic volumes were larger in PDE5-transgenic than in wild-type mice. PMID: 19139381
  29. These data suggests a novel physiological role for PDE5 in restricting the effects of NOS3/sGC/PKG signaling pathway to modulating beta-AR stimulated I(Ca), while limiting effects on cardiac contraction. PMID: 19345227

Show More

Hide All

Protein Families
Cyclic nucleotide phosphodiesterase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*