Recombinant Mycobacterium smegmatis Porin MspA (mspA)

In Stock
Code CSB-EP369785MVX
Abbreviation Recombinant Mycobacterium smegmatis mspA protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
mspA
Uniprot No.
Research Area
Others
Alternative Names
mspA; MSMEG_0965; MSMEI_0939; Porin MspA
Species
Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)
Source
E.coli
Expression Region
28-211aa
Target Protein Sequence
GLDNELSLVDGQDRTLTVQQWDTFLNGVFPLDRNRLTREWFHSGRAKYIVAGPGADEFEGTLELGYQIGFPWSLGVGINFSYTTPNILIDDGDITAPPFGLNSVITPNLFPGVSISADLGNGPGIQEVATFSVDVSGAEGGVAVSNAHGTVTGAAGGVLLRPFARLIASTGDSVTTYGEPWNMN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of the recombinant Mycobacterium smegmatis porin MspA begins with the creation of the recombinant plasmid, which is synthesized by co-inserting the gene encoding the Mycobacterium smegmatis MspA protein (28-211aa) with the N-terminal 10xHis-tag gene into a plasmid vector. The recombinant plasmid is introduced into E.coli cells. E.coli cells that can survive in the presence of a specific antibiotic are selected and then cultured under conditions conducive to the expression of the gene of interest. Following expression, the recombinant MspA protein is isolated and purified from the cell lysate using affinity purification. Denaturing SDS-PAGE is then employed to resolve the resulting recombinant Mycobacterium smegmatis MspA protein, demonstrating a purity exceeding 85%.

The protein MspA, found in Mycobacterium smegmatis, is a key player in moving charged particles across the cell membrane [1]. Unlike other outer membrane proteins, MspA stands out structurally and serves as the primary route for water-soluble molecules to enter Mycobacterium smegmatis [2]. Acting as the main doorway, MspA allows small, water-loving molecules to pass through the tough outer membrane [3]. Remarkably, even under harsh conditions like boiling or exposure to strong solvents, MspA maintains its structure, highlighting its stability [4]. Moreover, MspA is crucial for creating paths through the cell wall of Mycobacterium smegmatis [5].

MspA, forming eight parts with a single opening, is perfect for nanopore sequencing [6]. It's also the prototype of a new group of pore-forming proteins that have a single, large pore, enabling the movement of water-soluble molecules through the cell wall [7]. The gene responsible for MspA makes a precursor protein, which then gets processed into the mature form [8][9].

References:
[1] A. Perera, H. Wang, M. Basel, M. Pokhrel, P. Gamage, M. Kalitaet al., Channel blocking of mspa revisited, Langmuir, vol. 29, no. 1, p. 308-315, 2012. https://doi.org/10.1021/la3037296
[2] M. Pavlenok, The c‐terminus is essential for the stability of the mycobacterial channel protein mspa, Protein Science, vol. 33, no. 3, 2024. https://doi.org/10.1002/pro.4912
[3] D. Hillmann, I. Eschenbacher, A. Thiel, & M. Niederweis, Expression of the major porin gene mspa is regulated in mycobacterium smegmatis, Journal of Bacteriology, vol. 189, no. 3, p. 958-967, 2007. https://doi.org/10.1128/jb.01474-06
[4] S. Bossmann, K. Janik, M. Pokhrel, C. Heinz, & M. Niederweis, Reconstitution of a porin from mycobacterium smegmatis at hopg covered with hydrophobic host layers, Surface and Interface Analysis, vol. 36, no. 2, p. 127-134, 2004. https://doi.org/10.1002/sia.1671
[5] C. Stahl, S. Kubetzko, I. Kaps, S. Seeber, H. Engelhardt, & M. Niederweis, Mspa provides the main hydrophilic pathway through the cell wall of mycobacterium smegmatis, Molecular Microbiology, vol. 40, no. 2, p. 451-464, 2001. https://doi.org/10.1046/j.1365-2958.2001.02394.x
[6] I. Derrington, T. Butler, M. Collins, E. Manrao, M. Pavlenok, M. Niederweiset al., Nanopore dna sequencing with mspa, Proceedings of the National Academy of Sciences, vol. 107, no. 37, p. 16060-16065, 2010. https://doi.org/10.1073/pnas.1001831107
[7] C. Heinz, H. Engelhardt, & M. Niederweis, The core of the tetrameric mycobacterial porin mspa is an extremely stable β-sheet domain, Journal of Biological Chemistry, vol. 278, no. 10, p. 8678-8685, 2003. https://doi.org/10.1074/jbc.m212280200
[8] K. Heuner, B. Choi, R. Schade, A. Moter, A. Otto, & U. Göbel, Cloning and characterization of a gene (mspa) encoding the major sheath protein of treponema maltophilum atcc 51939t, Journal of Bacteriology, vol. 181, no. 3, p. 1025-1029, 1999. https://doi.org/10.1128/jb.181.3.1025-1029.1999
[9] M. Niederweis, S. Ehrt, C. Heinz, U. Klöcker, S. Karosi, K. Swidereket al., Cloning of the mspa gene encoding a porin from mycobacterium smegmatis, Molecular Microbiology, vol. 33, no. 5, p. 933-945, 1999. https://doi.org/10.1046/j.1365-2958.1999.01472.x"

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The major porin in this organism, forms a water-filled channel which favors the permeation of cations, amino acids, iron Fe(3+) and less efficiently phosphate. Does not transport Fe-ExoMS, the predominant siderophore. Plays a role in transport of beta-lactamase and hydrophilic fluoroquinolone antibiotics such as norfloxacin as well as chloramphenicol. There are about 2400 porins in wild-type, 800 in an mspA deletion and 150 in a double mspA-mspC deletion. Different conductance values with maxima at 2.3 and 4.6 nanosiemens might be caused by a simultaneous reconstitution of MspA channels into the membrane or by the existence of different MspA conformations.
Subcellular Location
Cell outer membrane. Secreted, cell wall.
Protein Families
Mycobacterial porin (TC 1.B.24) family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*