Recombinant Naja atra Cytotoxin 2

In Stock
Code CSB-EP365557NFG
Abbreviation Recombinant Naja atra Cytotoxin 2 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
others
Alternative Names
Cardiotoxin 1A;Cardiotoxin 2;CTX-2;Cardiotoxin A2;CTX A2;Cardiotoxin II;Cardiotoxin analog II
Species
Naja atra (Chinese cobra)
Source
E.coli
Expression Region
22-81aa
Target Protein Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Naja atra Cytotoxin 2 is produced using an E. coli expression system and contains the complete mature protein spanning amino acids 22 to 81. The engineered protein includes an N-terminal 10xHis-tag and a C-terminal Myc-tag, which makes purification and detection more straightforward. SDS-PAGE verification shows the product reaches purity levels above 85%, making it suitable for research work.

This cytotoxin comes from Chinese cobra venom and belongs to the three-finger toxin family. These proteins are particularly interesting because they can interact with cell membranes. Scientists find them valuable for studying how proteins bind to membranes and for exploring cell signaling pathways that might lead to new treatments.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Cytotoxin Structure-Function Studies

Researchers can use this recombinant cytotoxin 2 from Naja atra to examine what structural features drive snake venom cytotoxin activity. Comparing it with other cytotoxin variants may reveal important differences. The His and Myc tags make it easier to purify and detect the protein in biochemical tests that look at protein folding, stability, and shape changes.

Scientists might try circular dichroism spectroscopy, NMR studies, or X-ray crystallography to figure out this particular cytotoxin's three-dimensional structure. Since it's recombinant, researchers can perform site-directed mutagenesis experiments to pinpoint which amino acid residues are crucial for the toxin's deadly effects.

2. Membrane Interaction Assays

This cytotoxin appears useful for studying how proteins interact with membranes using artificial lipid bilayers or liposomes in controlled lab conditions. Scientists can examine binding kinetics and how the toxin creates holes in membranes using fluorescence-based tests or electrical measurements. The His-tag allows protein attachment to surfaces for surface plasmon resonance studies, which could help characterize how strongly the toxin binds to membranes.

These experiments may provide insights into the molecular mechanisms cobra cytotoxins use to interact with cell membranes.

3. Antibody Development and Immunological Studies

The dual-tagged recombinant protein works well as an antigen for creating specific antibodies against Naja atra cytotoxin 2 in research settings. The Myc tag makes detection and measurement straightforward in ELISA-based tests during antibody screening and characterization.

Researchers can study cross-reactivity patterns with other snake venom cytotoxins and develop methods to detect specific species. The recombinant protein also works in Western blot analysis and immunofluorescence studies to confirm antibody specificity.

4. Protein-Protein Interaction Studies

Scientists can use the His-tagged cytotoxin in pull-down experiments to find potential cellular binding partners or receptors that interact with this toxin variant. The protein can be attached to nickel-affinity matrices to screen cell extracts or protein libraries for new interaction partners.

The Myc tag offers another way to detect protein complex formation in co-immunoprecipitation experiments. These interaction studies might reveal previously unknown molecular targets and pathways that cobra cytotoxins affect.

5. Comparative Toxinology Research

This recombinant cytotoxin 2 enables side-by-side studies with cytotoxins from other Naja species to understand evolutionary relationships and species-specific differences in venom makeup. Researchers can perform parallel biochemical characterizations to identify unique properties of this cytotoxin compared to cytotoxin 1 or other variants.

Standardized recombinant production allows for consistent comparative analyses across different labs. Such studies contribute to our broader understanding of snake venom evolution and the functional diversity within cytotoxin families.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Basic protein that binds to cell membrane and depolarizes cardiomyocytes. It also shows lytic activities, but 2-fold less important than that of CTX-A4. It binds to the integrin alpha-V/beta-3 (ITGAV/ITGB3) with a moderate affinity. It may interact with sulfatides in the cell membrane which induces pore formation and cell internalization and is responsible for cytotoxicity in cardiomyocytes. It also may target the mitochondrial membrane and induce mitochondrial swelling and fragmentation.
Subcellular Location
Secreted. Target cell membrane.
Protein Families
Snake three-finger toxin family, Short-chain subfamily, Type IA cytotoxin sub-subfamily
Tissue Specificity
Expressed by the venom gland.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*