Recombinant Naja atra Cytotoxin 2

In Stock
Code CSB-EP365557NFG
Abbreviation Recombinant Naja atra Cytotoxin 2 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
others
Alternative Names
Cardiotoxin 1A;Cardiotoxin 2;CTX-2;Cardiotoxin A2;CTX A2;Cardiotoxin II;Cardiotoxin analog II
Species
Naja atra (Chinese cobra)
Source
E.coli
Expression Region
22-81aa
Target Protein Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Naja atra Cytotoxin 2 is produced using an E. coli expression system and contains the complete mature protein spanning amino acids 22 to 81. The engineered protein includes an N-terminal 10xHis-tag and a C-terminal Myc-tag, which makes purification and detection more straightforward. SDS-PAGE verification shows the product reaches purity levels above 85%, making it suitable for research work.

This cytotoxin comes from Chinese cobra venom and belongs to the three-finger toxin family. These proteins are particularly interesting because they can interact with cell membranes. Scientists find them valuable for studying how proteins bind to membranes and for exploring cell signaling pathways that might lead to new treatments.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant cytotoxin 2 protein is unlikely to be correctly folded or bioactive without experimental validation. Cytotoxins are small, highly structured proteins that require precise disulfide bond formation for their three-finger fold structure and membrane-interacting function. The E. coli expression system lacks the eukaryotic machinery for proper disulfide bond formation and may not support correct folding of this toxin. The dual tags (N-terminal 10xHis and C-terminal Myc) are particularly problematic for a small protein (60 amino acids), as they may constitute nearly half the molecular weight and severely disrupt the native structure. The purity >85% indicates some impurities, but does not guarantee correct folding. 

This recombinant cytotoxin can generate antibodies, but they will primarily recognize the immunodominant tags rather than native cytotoxin epitopes. If misfolded, antibodies may not recognize the physiological toxin. For specific antibodies, use tag-free, properly folded cytotoxin and validate against native venom components. The Myc tag provides a detection control but compromises antigen authenticity.

This recombinant cytotoxin 2 requires extensive validation before any functional application. Priority should be given to: 1) Removing both tags via proteolytic cleavage and purifying the tag-free protein; 2) Validating correct folding through circular dichroism to confirm the characteristic β-sheet pattern of three-finger toxins; 3) Verifying disulfide bond formation via mass spectrometry; 4) Confirming bioactivity with cytotoxicity assays on relevant cell lines. If native folding cannot be achieved, consider alternative expression systems (e.g., eukaryotic systems with oxidative folding capacity) or use purified native toxin from venom for critical studies. For antibody development, if using this protein, thoroughly characterize antibodies against venom-derived cytotoxin to ensure specificity.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Basic protein that binds to cell membrane and depolarizes cardiomyocytes. It also shows lytic activities, but 2-fold less important than that of CTX-A4. It binds to the integrin alpha-V/beta-3 (ITGAV/ITGB3) with a moderate affinity. It may interact with sulfatides in the cell membrane which induces pore formation and cell internalization and is responsible for cytotoxicity in cardiomyocytes. It also may target the mitochondrial membrane and induce mitochondrial swelling and fragmentation.
Subcellular Location
Secreted. Target cell membrane.
Protein Families
Snake three-finger toxin family, Short-chain subfamily, Type IA cytotoxin sub-subfamily
Tissue Specificity
Expressed by the venom gland.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*