Recombinant Neosartorya fumigata 1,3-beta-glucanosyltransferase gel4 (gel4)

In Stock
Code CSB-YP316454NGS
Abbreviation Recombinant Neosartorya fumigata gel4 protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
gel4
Uniprot No.
Research Area
Transferase
Alternative Names
Glucan elongating glucanosyltransferase 4
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Source
Yeast
Expression Region
26-519aa
Target Protein Sequence
KVLKACCWTIALDANSYGNKFFYSNNGTEFFIRGVAYQQEYQANGTSTENSDYTDPLANVDNCKRDIPYLKQLRTNVIRTYAVDPTKDHDECMKLLDDAGIYLITDLSAPSESINRADPAWNTDLYKRYTSVIDAFAKYSNVIGFFAGNEVANDNNNTNSIAYVKAAVRDMKSYIKSKDYRSSLLVGYATDDDAHIRADLADYLVCGDKESSIDMFGYNIYEWCGDSSFEKSGYKDRTEEFSKYPVPAFFSEYGCIDPKPRKFTDVAALYGPQMNDVWSGGIVYMYFQEANDYGLVSVSGDNVKTKEDFSYLSVQMQKVTATGVNSASYTASNTAVPTCPSVGAKWEASNKLPPSPNSELCDCMVETLSCTVKDSVDEKEYGDLFDYLCAAGVCGGINSNSTSGDYGAYSVCSAKQKLSFVMNQYYKKNNKAATACDFDGKAQTKKGADASGSCASLISQAGTAGTGSVTAGATGSSGSGSASETSKGAAGVAA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Neosartorya fumigata 1,3-beta-glucanosyltransferase gel4 is produced in a yeast expression system, delivering the full-length mature protein from amino acids 26 to 519. The protein includes an N-terminal 6xHis-tag, which streamlines purification and detection processes. SDS-PAGE analysis shows the protein achieves greater than 85% purity, suggesting reliable performance for various research applications. This product is intended strictly for research use only—not for diagnostic or therapeutic purposes.

1,3-beta-glucanosyltransferase gel4 from Neosartorya fumigata appears to play a crucial role in fungal cell wall biosynthesis. The enzyme seems particularly important in forming and remodeling beta-glucan polymers. Its activity may be vital for maintaining cell wall integrity, which makes it an attractive target for studying fungal growth and development. Understanding gel4's function could prove essential for research into antifungal strategies and broader fungal biology questions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Neosartorya fumigata 1,3-beta-glucanosyltransferase Gel4 is a fungal enzyme that requires precise folding, proper active site formation, and specific tertiary structure for its catalytic activity in cell wall biosynthesis. The yeast expression system is highly suitable for expressing fungal proteins as it provides a compatible eukaryotic folding environment, potential glycosylation, and disulfide bond formation. The N-terminal 6xHis-tag is relatively small and unlikely to cause significant steric interference. The expression of the full-length mature protein (26-519aa) in this system provides a high probability of correct folding with functional enzymatic activity, though experimental validation is still recommended.

1. In Vitro Enzyme Activity Characterization

This application is highly suitable. The yeast-expressed full-length enzyme has a high probability of being functionally active. The His-tag facilitates easy purification for kinetic studies (Km, Vmax) and substrate specificity assays. Activity should be validated using established glucanosyltransferase assays.

2. Antifungal Drug Screening Platform

This application is suitable provided enzyme activity is confirmed. The recombinant protein can serve as an excellent target for high-throughput screening of inhibitors. The yeast expression system likely produces a conformationally relevant target for identifying physiologically active compounds.

3. Antibody Development and Validation

This application is highly suitable. The full-length, properly folded protein expressed in a eukaryotic system presents authentic epitopes for generating high-quality antibodies specific to Gel4, useful for detection and localization studies in fungi.

4. Protein-Protein Interaction Studies

This application is suitable, with the caveat that interactions must be validated in the fungal context. The correctly folded protein can identify potential partners in cell wall biosynthesis complexes, but physiological relevance should be confirmed.

5. Structural and Biophysical Analysis

This application is highly suitable. The protein's high purity and likely correct folding make it appropriate for structural studies (X-ray, Cryo-EM) and biophysical characterization (DSC, CD) to understand its catalytic mechanism.

Final Recommendation & Action Plan

This yeast-expressed Gel4 with a small N-terminal His-tag is highly likely to be properly folded and functional due to the compatibility between the fungal protein and the yeast expression system. All proposed applications are suitable. Priority should be given to validating enzymatic activity (Application 1) as this confirms bioactivity fundamental to Applications 2 and 4. Applications 3 and 5 can proceed concurrently. This recombinant protein represents a well-suited tool for studying fungal cell wall biosynthesis and antifungal development.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Splits internally a 1,3-beta-glucan molecule and transfers the newly generated reducing end (the donor) to the non-reducing end of another 1,3-beta-glucan molecule (the acceptor) forming a 1,3-beta linkage, resulting in the elongation of 1,3-beta-glucan chains in the cell wall. Involved in cell wall morphogenesis.
Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families
Glycosyl hydrolase 72 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*