Recombinant Nostoc sp. All1616 protein (all1616)

In Stock
Code CSB-EP2964FUZa0
Abbreviation Recombinant Nostoc sp. All1616 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
all1616
Uniprot No.
Research Area
Others
Species
Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Source
E.coli
Expression Region
1-227aa
Target Protein Sequence
MRWVDDSYLLPAAKGLMSTSVPNTYAKLAKALLINYSFDLSGYHVDELVNRWQKQYPADWLHLAVIEALYQGRYKAISVQQLLAFWQRRGQEIYHFNMEFERLICSKFPESLTPMAASEQYSRQGKNQNQTLQLMSFKQQEQVKEEEEPPTEKMLALSSTSVTASIEVSVSQQEDYLGQPFSLNPDISTKLLPISVTHPPIGQFTPQTSDRSESFTSKLKAISNENS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.9 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Nostoc sp. All1616 protein is produced in E. coli with an N-terminal 6xHis-tag for easy purification and detection. The protein consists of the full-length sequence from amino acids 1 to 227. Its purity exceeds 85%, as confirmed by SDS-PAGE analysis, ensuring reliable performance in research applications. The product is provided with a low endotoxin level, making it suitable for various in vitro studies.

The All1616 protein from Nostoc sp. appears to play a role in the metabolic pathways of cyanobacteria, which may be crucial for understanding photosynthetic processes. As a component of these pathways, it could be integral to studies focusing on the biochemical and physiological functions of cyanobacteria. This might offer insights into broader biological processes related to energy conversion and environmental adaptation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

This application is reasonably suitable. As a prokaryotic protein expressed in a compatible system (E. coli), all1616 has a good probability of being correctly folded. The His-tag allows for effective pull-down assays to identify interaction partners from Nostoc lysates. However, validation with positive controls is still recommended to confirm specific interactions.

2. Antibody Development and Validation

This recombinant all1616 is excellent for generating specific antibodies. The full-length protein provides comprehensive epitope coverage, and the high purity ensures minimal cross-reactivity. Antibodies can be used for detecting all1616 in cyanobacterial samples.

3. Biochemical Characterization and Stability Studies

This is a priority application to confirm protein quality. Techniques like SEC and CD spectroscopy can assess oligomeric state and folding. These studies provide essential data for understanding the protein's biophysical properties. Initial characterization ensures the protein is properly folded and stable before functional studies.

4. Comparative Proteomics and Cross-Species Analysis

This protein is ideal as a reference standard for comparative studies across cyanobacterial species. Its prokaryotic origin ensures relevance for cross-species analyses within bacterial systems.

Final Recommendation & Action Plan

This recombinant all1616, being a prokaryotic protein expressed in a compatible E. coli system, is highly suitable for most applications, with a good probability of correct folding. Start with Application 3 (Biochemical Characterization) to confirm folding and stability. Once validated, proceed with Applications 1, 2, and 4 for interaction studies, antibody development, and comparative analyses. The compatibility between the protein's origin and the expression system reduces risks associated with misfolding, making this protein a reliable reagent for cyanobacterial research.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*