Recombinant Ornithodoros moubata Tick anticoagulant peptide

In Stock
Code CSB-EP325525OCK
Abbreviation Recombinant Ornithodoros moubata Tick anticoagulant peptide protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Uniprot No.
Research Area
others
Alternative Names
; Tick anticoagulant peptide; TAP
Species
Ornithodoros moubata (Soft tick) (Argasid tick)
Source
E.coli
Expression Region
1-60aa
Target Protein Sequence
YNRLCIKPRDWIDECDSNEGGERAYFRNGKGGCDSFWICPEDHTGADYYSSYRDCFNACI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.0kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of recombinant Ornithodoros moubata Tick anticoagulant peptide involves isolating the target gene, which encodes the 1-60aa of Tick anticoagulant peptide. This gene is fused with an N-terminal 10xHis-SUMO-tag and C-terminal Myc-tag gene and then cloned into an appropriate expression vector. The constructed vector is introduced into E. coli cells via transformation. The E. coli cells express the recombinant protein upon certain induction and are lysed to release the expressed protein. Purification of the recombinant protein is typically achieved using affinity chromatography. The final step involves analyzing the protein's purity through SDS-PAGE. Its purity is over 85%.

Tick anticoagulant peptide (TAP) is a significant protein found in the saliva of the Ornithodoros moubata tick. This peptide, consisting of 60 amino acids, acts as a potent inhibitor of human blood coagulation factor Xa (fXa) [1]. Studies have shown that TAP is highly specific to factor Xa and is capable of binding to both an exosite and the active site of the enzyme [2]. Furthermore, TAP has been identified as a low molecular weight serine protease inhibitor, specifically targeting factor Xa [3][4]. The presence of TAP in the saliva of Ornithodoros moubata contributes to the tick's ability to feed on blood by inhibiting coagulation at the feeding site, allowing for a continuous blood meal [3].

References:
[1] S. Jordan, L. Waxman, D. Smith, & G. Vlasuk, Tick anticoagulant peptide: kinetic analysis of the recombinant inhibitor with blood coagulation factor x.alpha., Biochemistry, vol. 29, no. 50, p. 11095-11100, 1990. https://doi.org/10.1021/bi00502a012
[2] K. Bromfield, N. Quinsey, P. Duggan, & R. Pike, Approaches to selective peptidic inhibitors of factor xa, Chemical Biology & Drug Design, vol. 68, no. 1, p. 11-19, 2006. https://doi.org/10.1111/j.1747-0285.2006.00404.x
[3] A. Gaspar, A. Joubert, J. Crause, & A. Neitz, Isolation and characterization of an anticoagulant from the salivary glands of the tick, ornithodoros savignyi (acari: argasidae), Experimental and Applied Acarology, vol. 20, no. 10, p. 583-598, 1996. https://doi.org/10.1007/bf00052809
[4] A. Gaspar, J. Crause, & A. Neitz, Identification of anticoagulant activities in the salivary glands of the soft tick, ornithodoros savignyi, Experimental and Applied Acarology, vol. 19, no. 2, p. 117-127, 1995. https://doi.org/10.1007/bf00052551

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
TAP is a slow, tight-binding inhibitor of blood coagulation, specific for factor Xa.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*