Recombinant Oxyuranus microlepidotus Toxin 3FTx-Oxy6

In Stock
Code CSB-EP415963OGE
Abbreviation Recombinant Oxyuranus microlepidotus Toxin 3FTx-Oxy6 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Uniprot No.
Research Area
others
Alternative Names
Three-finger toxin 3FTx-Oxy6
Species
Oxyuranus microlepidotus (Inland taipan)
Source
E.coli
Expression Region
22-81aa
Target Protein Sequence
LKCHESENLDDHVVCEEDETMCYKFTFVPFRDFEIVARGCSASCPEEKDVVCCSTDLCNK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Oxyuranus microlepidotus Toxin 3FTx-Oxy6 is expressed in E. coli and includes the full length of the mature protein, specifically the 22-81 amino acid region. The protein carries an N-terminal 10xHis-SUMO tag along with a C-terminal Myc tag to aid purification and detection. SDS-PAGE analysis shows it reaches greater than 85% purity, which appears to provide high-quality material for research applications.

3FTx-Oxy6 comes from the venom of the Inland taipan, one of the world's most venomous snakes. This protein belongs to the three-finger toxin family, which is known for disrupting cellular functions. Toxinology researchers find it particularly interesting due to its potential effects on ion channels and receptors. This makes it a valuable tool for studying neurotoxicity and related pathways, though the exact mechanisms may still require further investigation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Oxyuranus microlepidotus Toxin 3FTx-Oxy6 is a three-finger toxin that requires precise folding, proper disulfide bond formation (typically 4-5 conserved disulfide bonds), and specific tertiary structure for its neurotoxic activity. The E. coli expression system cannot provide the eukaryotic folding environment or oxidative conditions necessary for correct disulfide bond formation. The dual N-terminal 10xHis-SUMO tag (∼15 kDa) and C-terminal Myc tag (∼1.2 kDa) are extremely large relative to the small toxin size (∼7 kDa mature protein), creating severe steric interference that will disrupt the toxin's functional domains and binding interfaces. The probability of correct folding with functional activity is extremely low.

1. Biochemical Characterization and Structural Studies

Basic biophysical characterization can be performed, but will not reflect native toxin structure. The massive tags will dominate the protein's physical properties, making techniques like dynamic light scattering primarily measure tag behavior. Circular dichroism may detect secondary structure, but cannot verify functional disulfide bonding.

2. Antibody Development and Immunological Research

This application has limited utility. While antibodies can be generated, the immune response will primarily target the large foreign tags rather than the small toxin domain. Antibodies may not recognize conformational epitopes of the native, disulfide-bonded toxin.

Final Recommendation & Action Plan

This dual-tagged toxin construct is fundamentally unsuitable for functional research due to severe steric interference from the massive tags relative to the small toxin size. The combined tags (∼16 kDa) are more than twice the size of the toxin itself (∼7 kDa), making functional studies biologically irrelevant. Limited to basic physical characterization of the tagged protein (Application 1) and generating antibodies against linear epitopes (Application 2). For legitimate toxin research, use tag-free toxin produced by chemical synthesis or eukaryotic expression systems that support proper disulfide bond formation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Secreted.
Protein Families
Snake three-finger toxin family, Short-chain subfamily
Tissue Specificity
Expressed by the venom gland.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*