Recombinant Penaeus monodon Sarcoplasmic calcium binding protein

In Stock
Code CSB-EP2035ETF
Abbreviation Recombinant Penaeus monodon Sarcoplasmic calcium binding protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Cardiovascular
Source
E.coli
Expression Region
1-193aa
Target Protein Sequence
MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCSACYLFGPLKVVQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
38.1kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant sarcoplasmic calcium binding protein from Penaeus monodon is produced in E. coli and contains the complete protein sequence spanning amino acids 1 to 193. The protein carries an N-terminal 6xHis-SUMO tag, which makes purification and detection more straightforward. SDS-PAGE analysis indicates the product achieves over 90% purity, likely ensuring reliable results for research applications.

Sarcoplasmic calcium binding proteins appear to be central players in calcium ion regulation within muscle cells. They influence muscle contraction and relaxation processes, though the precise mechanisms may vary across species. Understanding this protein could shed light on calcium dynamics and related pathways, which is why it has become an important subject in physiological and biochemical research focused on calcium-dependent cellular activities.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Penaeus monodon Sarcoplasmic calcium-binding protein (SCP) is an EF-hand calcium-binding protein that requires precise folding, proper EF-hand domain formation, and specific calcium coordination for its functional activity. The E. coli expression system can produce soluble proteins but may not support optimal calcium-binding functionality without proper metal ion incorporation and oxidative folding conditions. The large N-terminal 6xHis-SUMO tag (∼15 kDa) may sterically interfere with the protein's EF-hand domains and calcium-binding interfaces. While the full-length protein (1-193aa) contains all functional domains, the probability of correct folding with functional calcium-binding activity requires experimental validation.

1. Calcium-Binding Protein Biochemical Characterization

This application carries a significant risk without functional validation. SCP's calcium-binding function requires precise EF-hand domain formation and metal ion coordination. If correctly folded and active (verified through calcium-binding assays), the protein may be suitable for binding studies. If misfolded/inactive (unverified), binding measurements will yield biologically meaningless results. The SUMO tag may sterically interfere with calcium-binding sites.

2. Comparative Evolutionary Studies of Calcium-Binding Proteins

Meaningful comparative studies require native protein conformation and functional activity. If correctly folded and active (verified), the protein enables valid evolutionary comparisons of calcium-binding properties. If misfolded/inactive (unverified), comparative analyses would yield misleading evolutionary insights about SCP conservation and divergence.

3. Antibody Development and Immunological Studies

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional protein folding. The full-length protein provides comprehensive epitope coverage for generating SCP-specific antibodies. The high purity (>90%) ensures minimal contamination-related issues during immunization protocols.

4. Protein-Protein Interaction Studies

This application requires proper folding validation. SCP interactions with other proteins require precise tertiary structure and calcium-binding capability. If correctly folded (verified), the protein may identify physiological interaction partners. If misfolded/unverified, there is a high risk of non-specific binding or failure to replicate genuine protein interactions.

5. In Vitro Functional Assays for Calcium Homeostasis Research

This application carries a high risk without functional validation. Calcium homeostasis studies require native protein conformation and proper calcium-binding functionality. If incorrectly folded, the protein will not exhibit authentic calcium-buffering activity and may yield biologically misleading results in functional assays.

Final Recommendation & Action Plan

The E. coli-expressed SCP with a large SUMO tag may not be properly folded for functional applications without experimental validation of calcium-binding capability. Begin with calcium-binding assays (e.g., isothermal titration calorimetry or fluorescence-based titration) to validate functionality before considering Applications 1, 2, 4, and 5. Application 3 (antibody development) can proceed immediately. For critical functional studies, consider removing the SUMO tag to minimize steric interference with calcium-binding domains. Always include appropriate calcium-binding controls and validate key findings with native protein preparations when possible for reliable SCP research.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*