Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Pollen allergen Phl p 5a; Allergen Phl p Va; allergen Phl p 5a; Fragment
Species
Phleum pratense (Common timothy)
Expression Region
1-286aa
Target Protein Sequence
ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The cDNA encoding residues Ala1 to Val286 of the Phleum pratense Pollen allergen Phl p 5a full-length protein was fused with a 6xHis-SUMO-tag at the N-terminus and then expressed in E.coli. The purity of this forming recombinant protein is greater than 90% measured by SDS-PAGE. It migrated to the molecular mass band of approximately 45-56 kDa on the gel under reducing conditions. In addition to generating specific antibodies, this recombinant allergen Phl p 5a protein may find uses in the studies of allergen or allergy.
Phl p 5a is an isoform of Phl p 5, which is a group 5 allergen from timothy grass and possesses high reactivity. Phl p 5 is highly allergenic and contains two active domains that lead to the production of high IgE levels. When Phl p 5 is recognized by IgE antibodies of almost all grass pollen allergic patients, strong IgE antibody cross-reactivity and T-cell responses responsible for allergy are induced. Sensitized patients develop heavy clinical reactions such as asthma. N. Najafi etc. demonstrated that Bet v 1-Phl p 5 recombinant fusion proteins form IgE-reactive aggregates with reduced allergenic activity.