Recombinant Phleum pratense Pollen allergen Phl p 5a, partial 

In Stock
Code CSB-EP669216EUQ
Abbreviation Recombinant Phleum pratense Pollen allergen Phl p 5a protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Allergen
Alternative Names
Pollen allergen Phl p 5a; Allergen Phl p Va; allergen Phl p 5a; Fragment
Species
Phleum pratense (Common timothy)
Source
E.coli
Expression Region
1-286aa
Target Protein Sequence
ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.5kDa
Protein Length
partial 
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The cDNA encoding residues Ala1 to Val286 of the Phleum pratense Pollen allergen Phl p 5a full-length protein was fused with a 6xHis-SUMO-tag at the N-terminus and then expressed in E.coli. The purity of this forming recombinant protein is greater than 90% measured by SDS-PAGE. It migrated to the molecular mass band of approximately 45-56 kDa on the gel under reducing conditions. In addition to generating specific antibodies, this recombinant allergen Phl p 5a protein may find uses in the studies of allergen or allergy.

Phl p 5a is an isoform of Phl p 5, which is a group 5 allergen from timothy grass and possesses high reactivity. Phl p 5 is highly allergenic and contains two active domains that lead to the production of high IgE levels. When Phl p 5 is recognized by IgE antibodies of almost all grass pollen allergic patients, strong IgE antibody cross-reactivity and T-cell responses responsible for allergy are induced. Sensitized patients develop heavy clinical reactions such as asthma. N. Najafi etc. demonstrated that Bet v 1-Phl p 5 recombinant fusion proteins form IgE-reactive aggregates with reduced allergenic activity.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Secreted.
Protein Families
Poa p IX/Phl p VI allergen family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*