Recombinant Phleum pratense Pollen allergen Phl p 5a, partial 

In Stock
Code CSB-EP669216EUQb3
Abbreviation Recombinant Phleum pratense Pollen allergen Phl p 5a protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Immunology
Alternative Names
Pollen allergen Phl p 5a; Allergen Phl p Va; allergen Phl p 5a; Fragment
Species
Phleum pratense (Common timothy)
Source
E.coli
Expression Region
1-286aa
Target Protein Sequence
ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.5 kDa
Protein Length
partial 
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Phleum pratense Pollen allergen Phl p 5a is produced in E. coli with a partial protein length of 1-286 amino acids. The protein carries an N-terminal 10xHis-SUMO tag along with a C-terminal Myc tag, which helps with purification and detection processes. SDS-PAGE analysis shows the product achieves greater than 85% purity, suggesting it meets quality standards for research applications. This product is intended for research use only.

Phleum pratense Pollen allergen Phl p 5a appears to be a significant component when studying grass pollen allergies. As an allergenic protein, it likely plays a crucial role in immune responses that pollen exposure triggers. Research into Phl p 5a tends to focus on understanding how it interacts with the immune system. This work may contribute to developing allergy diagnostics and potential therapeutic interventions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Allergen-Specific Antibody Development and Characterization

This recombinant Phl p 5a protein can work as an immunogen for generating monoclonal or polyclonal antibodies specific to timothy grass pollen allergens. The dual-tagged design with N-terminal His-SUMO and C-terminal Myc tags allows for efficient purification and detection during antibody screening. ELISA-based assays can leverage the Myc tag to identify high-affinity antibodies that specifically recognize the Phl p 5a allergen. These antibodies would likely prove valuable as research tools for studying allergen distribution, cross-reactivity patterns, and structural epitope mapping.

2. Protein-Protein Interaction Studies Using Pull-Down Assays

The N-terminal His tag makes it possible to immobilize the recombinant Phl p 5a protein on nickel-based affinity matrices for pull-down experiments. Researchers can incubate the immobilized protein with cell lysates or purified protein preparations to identify potential binding partners or interacting molecules. The C-terminal Myc tag offers an additional detection method to confirm protein integrity and loading in these interaction studies. This approach might reveal novel molecular interactions relevant to allergen function or processing pathways.

3. Structural and Biochemical Characterization Studies

The high purity level (>85%) and dual-tag system appear to make this protein suitable for detailed biochemical analysis and structural studies. The His tag allows for efficient purification protocols while the Myc tag works for protein detection and quantification in various analytical techniques. Researchers can subject the recombinant protein to biophysical characterization methods such as circular dichroism spectroscopy, dynamic light scattering, or analytical ultracentrifugation to study its folding properties and solution behavior. These studies would likely provide fundamental insights into the molecular properties of this timothy grass allergen.

4. Cross-Reactivity Analysis in Allergen Research

This recombinant Phl p 5a protein works as a standardized antigen for investigating cross-reactivity patterns between different grass pollen allergens in controlled laboratory settings. The consistent expression system and purification tags help ensure reproducible protein preparations for comparative binding studies. Competition assays or inhibition studies using this protein can examine how antibodies or other molecules interact with related allergens from different grass species. The Myc tag makes detection and quantification straightforward in multiplexed assay formats designed to study allergen cross-reactivity profiles.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Secreted.
Protein Families
Poa p IX/Phl p VI allergen family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*