Recombinant Phleum pratense Pollen allergen Phl p 5a, partial 

In Stock
Code CSB-EP669216EUQb3
Abbreviation Recombinant Phleum pratense Pollen allergen Phl p 5a protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Immunology
Alternative Names
Pollen allergen Phl p 5a; Allergen Phl p Va; allergen Phl p 5a; Fragment
Species
Phleum pratense (Common timothy)
Source
E.coli
Expression Region
1-286aa
Target Protein Sequence
ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.5 kDa
Protein Length
partial 
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Phleum pratense Pollen allergen Phl p 5a is produced in E. coli with a partial protein length of 1-286 amino acids. The protein carries an N-terminal 10xHis-SUMO tag along with a C-terminal Myc tag, which helps with purification and detection processes. SDS-PAGE analysis shows the product achieves greater than 85% purity, suggesting it meets quality standards for research applications. This product is intended for research use only.

Phleum pratense Pollen allergen Phl p 5a appears to be a significant component when studying grass pollen allergies. As an allergenic protein, it likely plays a crucial role in immune responses that pollen exposure triggers. Research into Phl p 5a tends to focus on understanding how it interacts with the immune system. This work may contribute to developing allergy diagnostics and potential therapeutic interventions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

As a pollen allergen, Phl p 5a's bioactivity depends on correct conformational epitopes for IgE antibody binding. E. coli expression typically cannot replicate eukaryotic post-translational modifications (e.g., glycosylation) that may affect allergenicity. The large dual-tag system (especially the N-terminal SUMO tag) may sterically hinder proper folding of conformational epitopes. While the protein may contain linear epitopes, its ability to mimic native allergen structure is uncertain without validation. High purity reduces non-specific effects but doesn't guarantee native folding. Therefore, this protein is unlikely to possess complete bioactivity (IgE binding capacity) without experimental confirmation.

1. Allergen-Specific Antibody Development and Characterization

This recombinant Phl p 5a can serve as an immunogen for antibody development targeting linear epitopes. The dual tags facilitate purification and detection during screening. However, antibodies generated may not recognize conformational epitopes of natural Phl p 5a due to potential misfolding. Validate antibody binding against native allergen extracts from timothy grass pollen for immunological applications.

2. Protein-Protein Interaction Studies Using Pull-Down Assays

The His tag enables immobilization for pull-down assays, but results may not reflect physiological interactions if the protein is misfolded. The tags themselves may cause non-specific binding. Any identified interactions must be confirmed using natural Phl p 5a to ensure biological relevance, especially for studies involving immune receptors like IgE.

3. Structural and Biochemical Characterization Studies

This protein is suitable for basic biophysical analysis (e.g., circular dichroism for secondary structure, dynamic light scattering for aggregation state). However, structural conclusions may not reflect the native allergen due to potential tag-induced conformational changes. Remove tags for meaningful structural insights into natural Phl p 5a.

4. Cross-Reactivity Analysis in Allergen Research

This protein can be used for cross-reactivity studies only if validated to retain conformational epitopes. Otherwise, linear epitope cross-reactivity may be detected, but this doesn't fully represent clinical allergen cross-reactivity. Always compare results with natural allergen extracts and include IgE binding assays from allergic patient sera for clinical relevance.

Final Recommendation & Action Plan

Before using this recombinant Phl p 5a for functional studies, validate its structural integrity and allergenicity. Perform circular dichroism to compare secondary structure with natural Phl p 5a, and conduct IgE binding ELISAs using sera from timothy grass-allergic patients to confirm antigenicity. If validation fails, limit use to linear epitope mapping or antibody production against linear sequences. For reliable allergen research, consider eukaryotic expression systems (e.g., insect cells) that better replicate natural protein folding and modifications. Always include natural Phl p 5a as a positive control in experiments.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Secreted.
Protein Families
Poa p IX/Phl p VI allergen family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*