Recombinant Phleum pratense Pollen allergen Phl p 5a

In Stock
Code CSB-EP669216EUQb3
Product Type Recombinant Protein
Size US$298Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q40962
Lead Time 3-7 business days
Relevance Allergen Phl p Va Allergen: Phl p 5a
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Phleum pratense (Common timothy)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence ADLGYGPATPAAPAAGYTPATPAAPAGADAAGKATTEEQKLIEKINAGFKAALAGAGVQPADKYRTFVATFGPASNKAFAEGLSGEPKGAAESSSKAALTSKLDAAYKLAYKTAEGATPEAKYDAYVATLSEALRIIAGTLEVHAVKPAAEEVKVIPAGELQVIEKVDAAFKVAATAANAAPANDKFTVFEAAFNDEIKASTGGAYESYKFIPALEAAVKQAYAATVATAPEVKYTVFETALKKAITAMSEAQKAAKPAAAATATATAAVGAATGAATAATGGYKV
Research Area Immunology
Source E.coli
Gene Names N/A
Expression Region 1-286aa
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 48.5 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Secreted
Protein Families Poa p IX/Phl p VI allergen family

Related Products

N/A Antibodies

N/A Antibodies for Phleum pratense

N/A Proteins

N/A Proteins for Phleum pratense (Common timothy)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.