Recombinant Pongo abelii Transmembrane protein 168 (TMEM168), partial

In Stock
Code CSB-EP023742PYX
Abbreviation Recombinant Pongo abelii TMEM168 protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
TMEM168
Uniprot No.
Research Area
Others
Alternative Names
TMEM168; Transmembrane protein 168
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Source
E.coli
Expression Region
527-637aa
Target Protein Sequence
EWWREKNGSFCSRLIIVLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.8 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Pongo abelii Transmembrane protein 168 (TMEM168) is expressed in E. coli, covering the amino acid region 527-637. This partial protein product features an N-terminal 10xHis-tag and a C-terminal Myc-tag for enhanced purification and detection. The protein shows a purity greater than 85%, as confirmed through SDS-PAGE analysis, which appears to ensure reliable results in experimental applications.

TMEM168 likely plays a role in cellular processes involving membrane dynamics and signaling. As a transmembrane protein, it seems to be implicated in various pathways related to cellular communication and structural integrity. Understanding TMEM168's function may be crucial for research in membrane biology and related fields, potentially offering insights into cell signaling and structural maintenance.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Pongo abelii TMEM168 is a transmembrane protein that requires precise folding, proper membrane integration, and specific tertiary structure for its functional activity. The E. coli expression system cannot provide the eukaryotic membrane environment or post-translational modifications required for this type of protein. The partial fragment (527-637aa) lacks the complete structural context and transmembrane domains essential for full functionality. The dual N-terminal 10xHis-tag and C-terminal Myc-tag may cause significant steric interference and prevent proper folding. The probability of correct folding with functional activity is extremely low.

1. Antibody Development and Epitope Mapping

This application is suitable for generating antibodies against linear epitopes within the 527-637aa region. Antibody development relies on antigenic sequence recognition rather than functional protein folding. However, antibodies may not recognize the native, membrane-integrated protein in its physiological context.

2. Structural and Biophysical Characterization Studies

Basic biophysical analysis can be performed, but will not reflect the native TMEM168 structure. Techniques like circular dichroism spectroscopy may detect secondary structure but cannot verify proper folding of a transmembrane domain without its membrane environment. The tags will dominate the protein's physical properties.

Final Recommendation & Action Plan
This dual-tagged TMEM168 fragment expressed in E. coli is unsuitable for functional studies due to the essential requirements for membrane integration that cannot be met in this expression system. The protein should not be used for interaction studies and comparative analysis. Application 1 (antibody development) can proceed for generating linear epitope antibodies. Application 2 provides only basic physical characterization of the fragment. For reliable TMEM168 research, use a full-length protein expressed in mammalian systems with proper membrane integration.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
TMEM168 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*