Recombinant Pongo abelii Transmembrane protein 168 (TMEM168), partial

In Stock
Code CSB-EP023742PYX
Abbreviation Recombinant Pongo abelii TMEM168 protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
TMEM168
Uniprot No.
Research Area
Others
Alternative Names
TMEM168; Transmembrane protein 168
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Source
E.coli
Expression Region
527-637aa
Target Protein Sequence
EWWREKNGSFCSRLIIVLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.8 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Pongo abelii Transmembrane protein 168 (TMEM168) is expressed in E. coli, covering the amino acid region 527-637. This partial protein product features an N-terminal 10xHis-tag and a C-terminal Myc-tag for enhanced purification and detection. The protein shows a purity greater than 85%, as confirmed through SDS-PAGE analysis, which appears to ensure reliable results in experimental applications.

TMEM168 likely plays a role in cellular processes involving membrane dynamics and signaling. As a transmembrane protein, it seems to be implicated in various pathways related to cellular communication and structural integrity. Understanding TMEM168's function may be crucial for research in membrane biology and related fields, potentially offering insights into cell signaling and structural maintenance.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The dual-tagged TMEM168 protein fragment (N-terminal His-tag and C-terminal Myc-tag) provides versatile options for investigating potential protein interactions. The His-tag enables immobilization on nickel-based resins for pull-down experiments with cell lysates or purified protein libraries. Meanwhile, the Myc-tag allows for detection and validation of interactions through Western blotting or immunoprecipitation approaches. This partial protein fragment (527-637aa) may retain key interaction domains that could reveal novel binding partners in primate cellular pathways.

2. Antibody Development and Epitope Mapping

This recombinant TMEM168 fragment can serve as an immunogen for generating specific antibodies against Pongo abelii TMEM168 or related primate orthologs. The 111-amino acid fragment appears to provide sufficient antigenic material for immunization protocols in laboratory animals. The dual tags help with purification and quality control during antibody production, while also enabling competitive binding assays to map epitope locations. Generated antibodies could prove valuable for studying TMEM168 expression and localization in primate tissue samples or cell culture systems.

3. Structural and Biophysical Characterization Studies

The purified TMEM168 fragment offers opportunities for detailed structural analysis using techniques such as circular dichroism spectroscopy, dynamic light scattering, and potentially NMR or crystallography studies. The high purity level (>85%) and defined boundaries (527-637aa) make this fragment suitable for investigating the folding properties and stability of this specific TMEM168 domain. Comparative structural studies between this Pongo abelii fragment and corresponding regions from other primate species could provide insights into evolutionary conservation and structural features.

4. Cross-Species Comparative Biochemical Analysis

This Pongo abelii TMEM168 fragment enables comparative studies with human and other primate TMEM168 orthologs to investigate species-specific differences in protein properties. The defined expression region (527-637aa) allows for production of equivalent fragments from other species for direct biochemical comparisons. Such studies might examine differences in protein stability, solubility, or interaction profiles between species. The dual-tag system provides consistent purification and detection methods across different species variants for standardized comparative analysis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
TMEM168 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*