Recombinant Rat Gamma-synuclein(Sncg)

Code CSB-EP737203RA
Size $2466Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names Sncg
Uniprot No. Q63544
Research Area Neuroscience
Alternative Names Persyn Sensory neuron synuclein
Species Rattus norvegicus (Rat)
Source E.coli
Expression Region 1-123aa
Target Protein Sequence MDVFKKGFSIAREGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKGERGTSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEEGEEAKSGGD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 17.1 kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time 13-23 business days
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Data

Function Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway (By similarity).
Gene References into Functions
  1. The present data reveal that GSyn exert a specific negative control on cocaine-induced reinforcing and incentive effects. PMID: 20579003
  2. Gamma-synuclein lacks a C-terminal domain that causes nuclear localisation of the fusion protein, suggesting that the two synucleins might have different roles relating to the cell nucleus. PMID: 15691713
  3. For gamma-synuclein, levels increased significantly only in the cerebral cortex and only from 5 d to 1 mo of age;levels in the cerebellum were very high at 5 d and significantly reduced at 1 mo of age. PMID: 17085784
  4. Coinjection of lentiviruses expressing DAT and gamma-synuclein - leading to overexpression of both proteins in the NAc - resulted in a strong increase in cocaine-induced rat locomotor activity suggesting a synergetic role of both proteins. PMID: 18588534
  5. gamma-Synuclein is selectively and abundantly expressed in human retinal ganglion cells (RGCs) in vivo, primary rat RGCs in vitro, and immortalized RGC-5 cells. PMID: 18728752

Show More

Hide All

Subcellular Location Cytoplasm, perinuclear region, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Cytoplasm, cytoskeleton, spindle
Protein Families Synuclein family
Tissue Specificity Specifically expressed in the peripheral nervous system. High expression in motoneurons of the brainstem. Also found in neurons of many other brain regions including the cerebellar cortex, thalmus, hypothalamus and CA1, CA2, CA3 and CA4 regions of the hip
Database Links

KEGG: rno:64347

STRING: 10116.ENSRNOP00000063571

UniGene: Rn.2883

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1