Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)

In Stock
Code CSB-YP750592RA
Abbreviation Recombinant Rat Ly6g6d protein (Active)
MSDS
Size $306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156 Biological Activity Assay
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 2 μg/mL can bind Anti-Ly6g6d recombinant antibody (CSB-RA013246MA4MO). The EC50 is 6.238-7.258 ng/mL.
Target Names
Ly6g6d
Uniprot No.
Research Area
Cell Biology
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
20-108aa
Target Protein Sequence
QRMRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN
Mol. Weight
11.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant rat Ly6g6d protein is an active, high-purity molecule produced in a yeast expression system, ensuring proper protein folding suitable for functional applications. It includes amino acids 20 to 108 of the native Ly6g6d sequence and is engineered with an N-terminal 6xHis tag to support efficient purification and detection. Available either in liquid or lyophilized form, this recombinant Ly6g6d protein demonstrates a purity greater than 95%, confirmed by both SDS-PAGE and SEC-HPLC. Functional activity is validated in a binding ELISA, where the immobilized Ly6g6d at 2 μg/mL specifically interacts with the anti-Ly6g6d recombinant antibody (CSB-RA013246MA4MO), showing an EC50 between 6.238 and 7.258 ng/mL. These properties make it a reliable tool for antibody screening, immune response research, and studies involving Ly6 family proteins.

The Ly6g6d protein has been implicated in various aspects of tumor biology, particularly in colorectal cancer (CRC). This glycosylphosphatidylinositol (GPI)-anchored protein is primarily expressed in colorectal tumors and has been found to play a significant role in modulating immune responses within the tumor microenvironment.

Recent studies have highlighted the upregulation of Ly6g6d in specific subtypes of CRC, particularly in microsatellite stable (MSS) tumors characterized by low expression of immune checkpoint receptors like PD-1/PD-L1 and an abundance of regulatory T cells (Tregs) [1][2]. This expression pattern suggests that Ly6g6d might contribute to a tumor-immune evasion mechanism, preventing effective anti-tumor responses by suppressing immune activity [3][2]. Furthermore, the modulation of Ly6g6d expression has been linked to pathways such as the AKT/p38 MAPK signaling pathway, indicating its involvement in the molecular signaling frameworks that govern immune responses in CRC [4][5].

Moreover, Ly6g6d's epigenetic regulation through DNA methylation processes further complicates its functional role. In certain mucinous subtypes of CRC, hypermethylation of the Ly6g6d gene may lead to diminished expression, thereby facilitating immune suppression and resistance to therapies such as FOLFOX [6][7]. This notion is corroborated by findings that suggest a correlation between increased Ly6g6d expression and enhanced immune infiltration in the tumor microenvironment, indicating that its expression might act as a double-edged sword, promoting immune recognition in some contexts while allowing tumor tolerance in others [2][7].

Additionally, the role of Ly6g6d as a potential target for immunotherapeutic strategies is gaining traction. Studies investigating bispecific antibodies targeting Ly6g6d have demonstrated promise in redirecting T-cell responses toward CRC cells, suggesting that manipulation of Ly6g6d expression or function could improve treatment outcomes by enhancing the immunogenicity of otherwise “immune-cold” tumor phenotypes [3][8]. Notably, the expression of Ly6g6d is not only a marker of tumor progression but also a promising biomarker for tailoring therapies aimed at optimizing anticancer immune responses, underscoring the need for further investigation into its functional mechanisms and therapeutic potential [2][7][8].

References:
[1] H. Liu, S. Chen, et al. Spatially resolved transcriptomics revealed local invasion-related genes in colorectal cancer. Frontiers in Oncology, vol. 13, 2023. https://doi.org/10.3389/fonc.2023.1089090
[2] L. Corrales, S. Hipp, et al. Ly6g6d is a selectively expressed colorectal cancer antigen that can be used for targeting a therapeutic t-cell response by a t-cell engager. Frontiers in Immunology, vol. 13, 2022. https://doi.org/10.3389/fimmu.2022.1008764
[3] P. Wang, L. Sun, et al. Novel anti-ly6g6d/cd3 t-cell–dependent bispecific antibody for the treatment of colorectal cancer. Molecular Cancer Therapeutics, vol. 21, no. 6, p. 974-985, 2022. https://doi.org/10.1158/1535-7163.mct-21-0599
[4] R. Luo, H. Li, et al. Shengqiyichang decoction regulates antitumor immunity in colorectal cancer by downregulating lymphocyte antigen 6 family member g6d via the protein kinase b/p38 mitogen-activated protein kinase signaling pathway. Heliyon, vol. 10, no. 21, p. e39071, 2024. https://doi.org/10.1016/j.heliyon.2024.e39071
[5] F. Caruso, M. D’Andrea, et al. Lymphocyte antigen 6g6d-mediated modulation through p38α mapk and dna methylation in colorectal cancer. Cancer Cell International, vol. 22, no. 1, 2022. https://doi.org/10.1186/s12935-022-02672-1
[6] F. Caruso, M. D’Andrea, et al. Ly6g6d is epigenetically activated in classical colorectal adenocarcinoma and hyper-methylated in mucinous subtypes determining resistance to folfox therapeutic regimens. 2021. https://doi.org/10.21203/rs.3.rs-783534/v1
[7] S. Amniouel and M. Jafri. High-accuracy prediction of colorectal cancer chemotherapy efficacy using machine learning applied to gene expression data. Frontiers in Physiology, vol. 14, 2024. https://doi.org/10.3389/fphys.2023.1272206
[8] P. Li and D. Huang. Targeting the jak-stat pathway in colorectal cancer: mechanisms, clinical implications, and therapeutic potential. Frontiers in Cell and Developmental Biology, vol. 12, 2024. https://doi.org/10.3389/fcell.2024.1507621

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*