Product Details

Purity

Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 2 μg/mL can bind Anti-Ly6g6d recombinant antibody (CSB-RA013246MA4MO). The EC50 is 6.238-7.258 ng/mL.

Target Names

Ly6g6d

Uniprot No.

Q6MG58

Research Area

Cell Biology

Species

Rattus norvegicus (Rat)

Source

Yeast

Expression Region

20-108aa

Target Protein Sequence

QRMRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN

Mol. Weight

11.7 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Lymphocyte antigen 6 complex locus protein G6d belongs to a family of GPI-anchored cell surface proteins implicated in immune cell signaling and lymphocyte activation, yet its precise functional role in rat immunology remains an active area of investigation. This recombinant protein, spanning the full mature sequence (aa 20–108) and expressed in yeast with an N-terminal 6xHis tag, demonstrates specific antibody binding in functional ELISA with an EC50 of 6.238–7.258 ng/mL when immobilized at 2 μg/mL, providing quantitative evidence that the protein retains native epitope presentation. The validated binding activity supports its use in antibody screening and characterization workflows, epitope mapping studies, and as a positive control in immunoassays targeting Ly6g6d. With purity exceeding 90% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this preparation meets the quality thresholds commonly required for cell-based binding assays and in vitro functional studies examining Ly6 family protein interactions.

Target Background

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor.

Database Links

KEGG: rno:415062

STRING: 10116.ENSRNOP00000001120

UniGene: Rn.145399

Code	CSB-YP750592RA
Abbreviation	Recombinant Rat Ly6g6d protein (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Rat Ly6g6d at 2 μg/ml can bind Anti-Ly6g6d recombinant antibody (CSB-RA013246MA4HU). The EC₅₀ is 6.238-7.258 ng/mL. Biological Activity Assay The purity of Ly6g6d was greater than 95% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage