Recombinant Rat Oncomodulin (Ocm)

In Stock
Code CSB-YP016264RA
Abbreviation Recombinant Rat Ocm protein
MSDS
Size $436
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Ocm
Uniprot No.
Research Area
others
Alternative Names
Parvalbumin beta
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
2-109aa
Target Protein Sequence
SITDILSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDIFRFIDNDQSGYLDGDELKYFLQKFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Oncomodulin (Ocm) is produced using a yeast expression system, which appears to deliver high-quality protein expression. The full-length mature protein carries an N-terminal 10xHis-tag that makes purification and detection more straightforward. SDS-PAGE analysis confirms the recombinant protein achieves greater than 90% purity. This product is intended strictly for research purposes and may serve as a reliable tool across different experimental setups.

Oncomodulin (Ocm) is a calcium-binding protein that seems to play a crucial role in cellular processes where calcium regulation matters. Its structure relates closely to calmodulin, making it particularly significant for studies that focus on calcium signaling pathways. The protein's involvement in cellular growth and differentiation likely makes it important for research exploring cellular development and regeneration.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Calcium-Binding Protein Interaction Studies

Researchers might use this recombinant rat oncomodulin to investigate calcium-dependent protein-protein interactions in laboratory settings. The N-terminal 10xHis tag allows for protein purification and immobilization during pull-down assays when searching for potential binding partners. Scientists can explore how calcium availability influences oncomodulin's interactions with other cellular proteins through co-immunoprecipitation or surface plasmon resonance approaches. The yeast expression system likely provides properly folded protein that works well for biochemical characterization of these interactions.

2. Antibody Development and Validation

This recombinant protein may serve as an excellent antigen for creating specific antibodies against rat oncomodulin. The >90% purity level appears sufficient for immunization protocols during antibody production. His-tagged protein can be applied in ELISA-based screening to identify high-affinity antibodies and confirm their specificity. This application supports developing research tools for studying oncomodulin expression and localization in rat tissues and cell lines.

3. Biochemical Characterization of Calcium-Binding Properties

The purified recombinant oncomodulin offers opportunities to study its calcium-binding kinetics and thermodynamics through methods like isothermal titration calorimetry or fluorescence spectroscopy. Scientists can determine binding constants, stoichiometry, and conformational changes that occur upon calcium binding. The His tag makes protein purification and concentration determination simpler for quantitative biochemical assays. These studies may provide fundamental insights into oncomodulin's molecular properties and calcium-sensing mechanisms.

4. Comparative Species Analysis

This rat oncomodulin can work alongside oncomodulin proteins from other species during comparative biochemical studies. Scientists might examine species-specific differences in calcium sensitivity, protein stability, or binding partner preferences through parallel in vitro assays. The standardized expression system and His tag purification approach appears to ensure consistent protein quality for reliable comparative analysis. Such studies could contribute to understanding evolutionary conservation and divergence of oncomodulin function across mammalian species.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.
Gene References into Functions
  1. Oncomodulin expression begins between postnatal day 2 and P4 and peaks as early as P10; it is uniquely expressed by the outer hair cells (OHCs) in the rat cochlea and occurs after efferent innervation along the cochlear spiral between P2 and P4. PMID: 14978725
  2. Thus, oncomodulin is a new growth factor for neurons of the mature central and peripheral nervous systems. PMID: 16699509
  3. Solution structure of Ca2+-free oncomodulin is reported. PMID: 17766386
  4. Leucine 85 is an important determinant of divalent ion affinity in rat beta-parvalbumin PMID: 19075559
  5. Oncomodulin is a growth factor for neurons of the mature central and peripheral nervous systems. PMID: 16699509

Show More

Hide All

Protein Families
Parvalbumin family
Tissue Specificity
Found in tumor tissues and not detected in normal tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*