Recombinant Rat Oncomodulin (Ocm)

In Stock
Code CSB-YP016264RA
Abbreviation Recombinant Rat Ocm protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Ocm
Uniprot No.
Research Area
others
Alternative Names
Parvalbumin beta
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
2-109aa
Target Protein Sequence
SITDILSAEDIAAALQECQDPDTFEPQKFFQTSGLSKMSASQVKDIFRFIDNDQSGYLDGDELKYFLQKFQSDARELTESETKSLMDAADNDGDGKIGADEFQEMVHS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Oncomodulin (Ocm) is produced using a yeast expression system, which appears to deliver high-quality protein expression. The full-length mature protein carries an N-terminal 10xHis-tag that makes purification and detection more straightforward. SDS-PAGE analysis confirms the recombinant protein achieves greater than 90% purity. This product is intended strictly for research purposes and may serve as a reliable tool across different experimental setups.

Oncomodulin (Ocm) is a calcium-binding protein that seems to play a crucial role in cellular processes where calcium regulation matters. Its structure relates closely to calmodulin, making it particularly significant for studies that focus on calcium signaling pathways. The protein's involvement in cellular growth and differentiation likely makes it important for research exploring cellular development and regeneration.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Rat Ocm is a calcium-binding protein belonging to the EF-hand superfamily that requires precise folding and proper EF-hand domain formation for its calcium-binding functionality. The yeast expression system provides a eukaryotic environment that supports proper protein folding, disulfide bond formation, and post-translational modifications, significantly increasing the probability of correct folding compared to bacterial systems. The N-terminal 10xHis tag is relatively small and unlikely to interfere with the protein's calcium-binding domains. However, experimental validation remains essential to confirm both structural integrity and functional calcium-binding activity.

1. Calcium-Binding Protein Interaction Studies

This application's reliability depends entirely on proper folding validation. Calcium-dependent protein interactions require precise tertiary structure formation of EF-hand domains. If correctly folded and calcium-binding competent (verified), the protein is highly suitable for studying physiological interaction partners in calcium signaling pathways. If misfolded/unverified, there is high risk of non-specific binding or interaction failure, making results biologically misleading.

2. Antibody Development and Validation

Antibody development primarily relies on antigenic sequence recognition rather than functional folding. If correctly folded (verified), the protein excels for generating conformation-sensitive antibodies that recognize native oncomodulin epitopes. If misfolded/unverified, it remains highly suitable for producing antibodies against linear epitopes, which are still valuable for detection applications.

3. Biochemical Characterization of Calcium-Binding Properties

These studies are essential for determining folding status and functional competence. If correctly folded and active (verified), characterization provides reliable data on calcium-binding kinetics, stoichiometry, and conformational changes. If misfolded/unverified, analysis yields physical property data, but calcium-binding assays will not reflect native activity.

4. Comparative Species Analysis

Meaningful comparative studies require native protein conformation and functional activity. If correctly folded and calcium-binding competent (verified), the protein enables valid functional comparisons with oncomodulin orthologs from other species. If misfolded/unverified, comparative analyses would yield misleading results about evolutionary relationships and functional differences.

Final Recommendation & Action Plan

The yeast expression system provides favorable eukaryotic folding conditions for this calcium-binding protein, but experimental validation of structural integrity and calcium-binding activity is essential before reliable use in functional studies. Begin with Application 3 (Biochemical Characterization) to assess folding quality through circular dichroism spectroscopy (EF-hand structure analysis), size-exclusion chromatography, and validate calcium-binding activity using isothermal titration calorimetry or fluorescence-based assays. If correct folding and calcium-binding functionality are verified, proceed confidently with Applications 1 and 4 for interaction studies and comparative analyses. Application 2 (antibody development) can proceed immediately regardless of folding status. If misfolding or lack of calcium-binding is detected, limit applications to linear epitope antibody production and basic biophysical characterization, avoiding all functional interaction and comparative studies. For reliable oncomodulin research, always include appropriate calcium-binding controls and consider the protein's calcium-dependent conformational changes in experimental design.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.
Gene References into Functions
  1. Oncomodulin expression begins between postnatal day 2 and P4 and peaks as early as P10; it is uniquely expressed by the outer hair cells (OHCs) in the rat cochlea and occurs after efferent innervation along the cochlear spiral between P2 and P4. PMID: 14978725
  2. Thus, oncomodulin is a new growth factor for neurons of the mature central and peripheral nervous systems. PMID: 16699509
  3. Solution structure of Ca2+-free oncomodulin is reported. PMID: 17766386
  4. Leucine 85 is an important determinant of divalent ion affinity in rat beta-parvalbumin PMID: 19075559
  5. Oncomodulin is a growth factor for neurons of the mature central and peripheral nervous systems. PMID: 16699509

Show More

Hide All

Protein Families
Parvalbumin family
Tissue Specificity
Found in tumor tissues and not detected in normal tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*