Recombinant Rat Sulfotransferase family cytosolic 1B member 1 (Sult1b1)

In Stock
Code CSB-EP022937RA
Abbreviation Recombinant Rat Sult1b1 protein
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Sult1b1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Sult1b1; St1b1; Sulfotransferase family cytosolic 1B member 1; ST1B1; Sulfotransferase 1B1; EC 2.8.2.-; DOPA/tyrosine sulfotransferase
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
1-299aa
Target Protein Sequence
MGTAEDVFRKDLKIIHGYPMVYAFALGWEKIEEFQSRPCDIVIPTYPKSGTTWLSEIVDMVLNDGNVEKCKRDVITSKVPMLEQNVPGARRSGVELLKKTPSPRIIKTHLPIDLLPKSFWDNKCKMIYLARNGKDVAVSYYHFDLMNNIQPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREGHPILFLYYEDLKKNPKKEIKKIANFLDKTLDEHTLERIVHHTSFEVMKDNPLVNYTHLPTEIMDHSKSPFMRKGVVGDWKNYFTMTQSEKFDAIYKKKLSGTTLEFCTDIQSA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.8 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Rat Sult1b1 contains amino acids 1-299. The calculated molecular weight for this Sult1b1 protein is 54.8 kDa. This Sult1b1 recombinant protein is manufactured in e.coli. The Sult1b1 coding gene included the N-terminal 10xHis-SUMO tag and C-terminal Myc tag, which simplifies the detection and purification processes of the recombinant Sult1b1 protein in following stages of expression and purification.

Sulfotransferase family cytosolic 1B member 1 (Sult1b1) is an enzyme belonging to the sulfotransferase family, playing a crucial role in the phase II detoxification pathway. Sult1b1 is responsible for catalyzing the transfer of a sulfate group from 3'-phosphoadenosine-5'-phosphosulfate (PAPS) to a variety of substrates, including hormones, drugs, and xenobiotics. This sulfonation process enhances the water solubility of these compounds, facilitating their excretion from the body. In rats, Sult1b1 is expressed in various tissues, with prominent activity in the liver. Understanding the function of Sult1b1 is essential for elucidating detoxification mechanisms, drug metabolism, and the regulation of endogenous substances in rodents. Research on Sult1b1 contributes to advancements in drug development, toxicology, and the overall comprehension of metabolic pathways in rats.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine (T3) and reverse triiodothyronine (rT3).
Gene References into Functions
  1. Both fipronil and fipronil sulfone treatments induced a 2.5-fold increase in Ugt1a1 and Sult1b1 messenger RNA (mRNA) expressions. PMID: 22447239
  2. Chinese hamster V79-derived cell lines (V79-rSULT1B1-A and -B) that express rat sulfotransferase 1B1 (rSULT1B1) activated promutagenic benzylic alcohols into mutagens with more than 100-fold cytotoxicity. PMID: 12419836
  3. importance of these enzymes for the sulfation of iodothyronines in rat liver, with a greater contribution of in male than in female liver and it also contributes to iodothyronine sulfation in rat kidney PMID: 12773305
Subcellular Location
Cytoplasm.
Protein Families
Sulfotransferase 1 family
Database Links

KEGG: rno:64305

UniGene: Rn.1183

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*