Recombinant Rat Transient receptor potential cation channel subfamily A member 1 (Trpa1), partial

In Stock
Code CSB-EP764869RA
Abbreviation Recombinant Rat Trpa1 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Trpa1
Uniprot No.
Research Area
Others
Alternative Names
(Ankyrin-like with transmembrane domains protein 1)(Wasabi receptor)
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
960-1125aa
Target Protein Sequence
IGLAVGDIAEVQKHASLKRIAMQVELHTNLEKKLPFWYLRKVDQRSTIVYPNRPRHGRMLRFFHYFLSMQETRQEAPNIDTCLEMEILKQKYRLKDLTSLLEKQHELIKLIIQKMEIISETEDEDNHCSFQDRFKKERLEQMHSKWNFVLNAVKTKTHCSISHPDI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.3 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Rat Trpa1 protein production is accomplished by manipulating the expression of the desired gene in e.coli cells. The sequence (960-1125aa) of foreign DNA is incorporated into an expression vector and subsequently introduced into e.coli cells. Positive cells are selected and cultured to induce the expression of the desired protein. The protein carries a N-terminal 10xHis tag and C-terminal Myc tag. The resulting recombinant Rat Trpa1 protein undergoes affinity purification, with a purity surpassing 85%, as measured by SDS-PAGE.

Citations

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor-activated non-selective cation channel involved in pain detection and possibly also in cold perception, oxygen concentration perception, cough, itch, and inner ear function. Shows 8-fold preference for divalent over monovalent cations. Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of irritants, such as allylthiocyanate (AITC) found in mustard oil or wasabi, cinnamaldehyde, diallyl disulfide (DADS) from garlic, and acrolein, an irritant from tears gas and vehicule exhaust fumes. Acts also as an ionotropic cannabinoid receptor by being activated by delta(9)-tetrahydrocannabinol (THC), the psychoactive component of marijuana. Is activated by a large variety of structurally unrelated electrophilic and non-electrophilic chemical compounds. Electrophilic ligands activate TRPA1 by interacting with critical N-terminal Cys residues in a covalent manner, whereas mechanisms of non-electrophilic ligands are not well determined. May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system.
Gene References into Functions
  1. TRPA1-mediated spontaneous [Ca(2+)]i increase modulates the spontaneous release of peptide hormones from astrocytes. PMID: 29777700
  2. Upregulated substance P (SP) and TRPA1 in the dorsal root ganglion and stomach and increased serum and gastric mucosa SP levels may contribute to stress-induced acute gastric mucosal lesions. PMID: 29428952
  3. IL-6 synthesis and secretion were connected to acute Peritoneal dialysis fluid exposure, and this response was triggered by TRPA1 receptors, possibly located to non-neuronal cells. PMID: 28698251
  4. The TRPA1 channel is activated by noxious cold, reactive oxygen species and mechanical stimuli and is expressed in small- and medium-sized nociceptive neurons of the dorsal root, trigeminal, and nodose ganglia. PMID: 28640016
  5. TRPA1 receptors on nociceptors are active in incised fascia and muscle but this is not evident in incised skin. Even though endogenous TRPA1 agonists like ROS and H2O2 were increased in both incised skin and muscle, those in skin do not contribute to nociceptive behaviors. PMID: 28103292
  6. Tetracaine facilitated spontaneous l-glutamate release from nerve terminals by activating TRPA1 channels in the substantia gelatinosa (SG), resulting in an increase in the excitability of SG neurons. TRPA1 activation was not specific to amide-type or ester-type local anesthetics (LAs). The facilitatory action of LAs may be involved in pain occurring after recovery from spinal anesthesia. PMID: 28017670
  7. expression in distal colonic mucosa may be involved restored colonic transit after pelvic nerve denervation PMID: 28032561
  8. High TRPA1 expression is associated with neuropathic pain. PMID: 28370084
  9. TRPA1 functions as a sensor that is activated by reactive aldehydes and is modulated when intracellular changes in oxygen levels occur. PMID: 27748654
  10. data suggest that cardamonin is a selective TRPA1 antagonist, providing novel insight into the target of its anti-nociceptive activity. PMID: 27589700
  11. Our results indicate that cannabinoids can enhance the mechanosensitivity of TG endings in the inner walls of anterior chambers of rat eye via TRPA1 activation. PMID: 27752892
  12. TRPA1-channels involvement in the activation of bladder DSM contraction of normal rats and rats with experimental diabetes. Our data show that diabetes affects TRPA1-dependent mechanisms of DSM contractility mainly via an overall inflammatory reaction associated with diabetes, which leads to an enhanced functional coupling between the tachykinin and prostanoid systems. PMID: 26935999
  13. Spinal TRPA1 may contribute to facilitation of morphine antinociceptive tolerance. PMID: 26922555
  14. Report activation of TRPA1 by o-chlorobenzylidene malononitrile as model of neuropathic pain. PMID: 26046936
  15. Meningeal blood flow is controlled by H2S-NO crosstalk activating a HNO-TRPA1-CGRP signalling pathway PMID: 25884403
  16. TRPA1 expression via activation of p38 MAPK in DRG neurons, at least in part, contributes to the development of oxaliplatin-induced acute cold hyperalgesia. PMID: 26567040
  17. The results of this study showed that TRPA1 in muscle afferents plays an important role in the development of acute mechanical hypersensitivity and in the maintenance of persistent muscle pain and hypersensitivity. PMID: 26393428
  18. H2S has both inhibitory and excitatory effects by opening KATP and TRPA1 channels, respectively, in RIN14B cells, suggesting potential bidirectional modulation of secretory functions. PMID: 26172081
  19. The TRPA1 channel mediates the analgesic action of dipyrone and pyrazolone derivatives PMID: 25765567
  20. TRPA1 appears to be localized not only at presynaptic terminals on SG neurons, enhancing glutamate release PMID: 25896791
  21. Results suggested that TRPA1 mechanisms play a significant role in the sensitization of ocular-responsive trigeminal brainstem neurons in this model for tear deficient dry eye PMID: 25639234
  22. TRPA1 is a major mediator of the proinflammatory/proalgesic actions of aromatase inhibitors PMID: 25484020
  23. TRPA1 channel has a role in activation of mechanosensitive afferent nerve activities of both Adelta- and C-fibers of the rat bladder, although its role in a physiological condition might be small. PMID: 23784920
  24. TRPA1 activation by H2O2 mediates the entire inflammatory response in an acute gout attack rodent model PMID: 24780252
  25. The results suggest that TRPA1 channels in rat odontoblastgs are involved in sensing membrane stretching and low-temperature stimulation. PMID: 24358160
  26. TRPA1 is essential to the in vivo nociceptive effects induced by one of the most important mediators of inflammatory pain, prostaglandin E. PMID: 24607781
  27. Hydrogen sulfide directly activates TRPA1 and its increment of diffusion into cells may be involved in the potentiation of TRPA1 activation under external acidic conditions. PMID: 23873754
  28. the actions of cyclooxygenase metabolites are mediated through the functioning of the TRPV1 and TRPA1 receptors PMID: 23832015
  29. TRPA1 might be involved in the pathophysiological process of ventilator-induced lung injury PMID: 23846257
  30. Cold activates rat and mouse TRPA1 but not human or rhesus monkey TRPA1. A single residue within the S5 transmembrane domain (G878 in rodent but V875 in primate) accounts for the difference in cold sensitivity. PMID: 24071625
  31. Reactive oxygen species enhance synaptic transmission in dorsal horn cells through TRPA1 (and TRPV1) channel activation. PMID: 23707800
  32. Data suggest spinal TRPA1 channels in posterior horn cells are involved in mechanical pain hypersensitivity, in increased cutaneous blood flow due to antidromic activation of nociceptive nerves, and in pronociceptive action of dynorphin A. PMID: 23959730
  33. Monosodium urate injection increases tissue H2 O2 , thereby stimulating TRPA-1 on sensory nerve endings to produce inflammation and nociception. PMID: 23918657
  34. H2S induces a nonspecific sensitizing effect on capsaicin-sensitive lung vagal fibers to both chemical and mechanical stimulation in rat lungs, which appears mediated through an action on the TRPA1 receptors. PMID: 23842678
  35. Gene silencing of TRPA1 completely prevents carrageenan-induced hyperalgesia and significantly reduces TRPA1 expression in dorsal root ganglia cells. PMID: 23098993
  36. The results of this study demonstrated that TRPA1 mediates some of the key inflammatory mechanisms, suggesting a key role of this receptor in pain and inflammation. PMID: 23521647
  37. Factors that stimulate TRPA1 channels expand Ca2+ signal-effector coupling at discrete sites along the endothelium to evoke graded cerebral artery vasodilation. PMID: 22928941
  38. TRPA1 channel in the skin contributes to sustained as well noxious mechanical stimulus-evoked postoperative pain PMID: 22588108
  39. Hydrogen sulfide activates TRPA1 receptors causing CGRP release from sensory nerves of rat tracheae. PMID: 22721614
  40. TRPA1 is functionally expressed primarily by IB4-binding, non-peptidergic mouse and rat sensory neurons PMID: 23133534
  41. Trpa1 expression in female Wistar rats varied with postnatal age, tissue (urothelium, detrusor, or whole bladder), and duration (4-h, 48-h, or chronic) of cyclophosphamide-induced cystitis. PMID: 22865090
  42. TRPA1 contributes to cold-induced contractions of the rat colon smooth muscle, and the mechanism involves the PLC/IP(3)/Ca(2+) pathway. PMID: 20717636
  43. TRPA1 is expressed on a substantial fraction of dural afferents, and activation of meningeal TRPA1 produces behaviors consistent with those observed in patients during migraine attacks. PMID: 22809691
  44. Methylglyoxal activates nociceptors through transient receptor potential channel A1 (TRPA1): a possible mechanism of metabolic neuropathies. PMID: 22740698
  45. Study propose that endogenous and exogenous ligands of TRPA1 cause Ca(2) influx and induce basal insulin release and that TRPA1-mediated depolarization acts synergistically with K(ATP) channel blockade to facilitate insulin release. PMID: 22701540
  46. The results indicate that warmth suppresses and desensitizes damage-sensing ion channel TRPA1. PMID: 22458587
  47. TRPA1 channel exerts an important role in the pathogenesis of peripheral diabetic neuropathy. Blocking the TRPA1 channel provides a selective disease-modifying treatment of PDN. PMID: 22133672
  48. The electrophysiological characteristics of TRPA1 suggest that it might play a unique role in nociception. PMID: 21653898
  49. These findings that a short-term application of artemin inhibits the TRPA1 channel's activity and the sequential pain behaviors suggest a role of artemin in regulation of sensory neurons. PMID: 21619614
  50. Data show that the TRPA1 activation and upregulation seem to exert an important role in overactive bladder following spinal cord injury. PMID: 21367919

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Transient receptor (TC 1.A.4) family
Tissue Specificity
Specifically expressed in a subset of nociceptive neurons. Expressed in dorsal root ganglia.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*