Recombinant Saccharomyces cerevisiae Acyl-CoA-binding protein (ACB1)

In Stock
Code CSB-YP006519SVG
Abbreviation Recombinant Saccharomyces cerevisiae ACB1 protein
MSDS
Size US$436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
ACB1
Uniprot No.
Research Area
Others
Alternative Names
ACB1; ACB; YGR037CAcyl-CoA-binding protein; ACBP
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Source
Yeast
Expression Region
1-87aa
Target Protein Sequence
MVSQLFEEKAKAVNELPTKPSTDELLELYALYKQATVGDNDKEKPGIFNMKDRYKWEAWENLKGKSQEDAEKEYIALVDQLIAKYSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
12.1kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Saccharomyces cerevisiae Acyl-CoA-binding protein (ACB1) is expressed in yeast and includes an N-terminal 6xHis tag for efficient purification. This full-length protein spans amino acids 1-87 and shows purity greater than 90% as confirmed by SDS-PAGE. Intended for research use only, it appears to be a reliable tool for various biochemical assays, with low endotoxin levels that make it suitable for sensitive applications.

The Acyl-CoA-binding protein (ACB1) from Saccharomyces cerevisiae likely plays a crucial role in intracellular lipid metabolism. It participates in the binding and transport of acyl-CoA esters, supporting key processes in lipid biosynthesis and degradation. Given its fundamental role in lipid homeostasis, ACB1 has become an important focus in research studying metabolic pathways in eukaryotic cells, particularly in yeast models.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant Saccharomyces cerevisiae ACB1 is produced in a yeast expression system as a full-length protein (1-87aa) with an N-terminal 6xHis-tag. This represents a homologous expression scenario where the protein is expressed in its native host organism. Yeast expression systems contain the appropriate chaperones and folding machinery needed for proper ACB1 folding, including the capacity for correct disulfide bond formation if required. ACB1 is a relatively small protein (10 kDa) that typically functions as a monomeric acyl-CoA-binding protein, which simplifies proper folding. The 6xHis tag is small and unlikely to significantly interfere with folding. Purity >90% by SDS-PAGE indicates good production quality. In this homologous system, the probability of correct folding and bioactivity is very high. However, without specific validation data (e.g., acyl-CoA binding assays, circular dichroism), folding and bioactivity cannot be conclusively confirmed without verification, though the system is optimal for producing functional protein.

1. Lipid Metabolism Research and Acyl-CoA Binding Studies

This recombinant ACB1 is suitable for acyl-CoA binding studies since it's expressed in its native host system, which should preserve its natural folding and function. The small His-tag is unlikely to interfere with the binding pocket, making kinetic and specificity studies reliable. Binding assays using surface plasmon resonance or other biophysical methods should yield biologically relevant results that accurately reflect ACB1's role in yeast lipid metabolism.

2. Protein-Protein Interaction Studies

The recombinant ACB1 is well-suited for interaction studies as the native folding ensures proper presentation of interaction interfaces. The His-tag facilitates pull-down assays to identify genuine binding partners in yeast metabolic pathways. Since the protein is correctly folded in its native system, results should accurately reflect ACB1's natural protein interaction networks without significant tag-related artifacts.

3. Antibody Development and Validation

This application is suitable as the recombinant protein presents native conformational epitopes due to proper folding in the yeast expression system. Antibodies generated will likely recognize the natural ACB1 protein in various applications. The high purity and authentic folding ensure that antibodies will have optimal specificity for biological studies in yeast systems.

4. Comparative Protein Structure and Function Analysis

The recombinant ACB1 can be used for comparative studies since the native yeast expression system produces a properly folded protein with an authentic structure. Biophysical characterization (circular dichroism, NMR) will yield accurate data on the native protein's conformation, enabling meaningful cross-species comparisons of acyl-CoA-binding protein evolution and function.

Final Recommendation & Action Plan

This recombinant ACB1 expressed in its native yeast host has a high probability of being properly folded and functional, making it suitable for all proposed applications with minimal concerns. The recommended action plan includes: proceeding with applications while including standard controls; for binding studies, validate with known acyl-CoA ligands as positive controls; for structural comparisons, consider removing the His-tag if highest resolution is needed, though it likely has minimal impact; this protein can be used with high confidence for yeast ACB1 research without the need for extensive validation typically required for heterologous expression systems.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters.
Gene References into Functions
  1. These experiments reveal a unique secretory pathway where autophagosomes containing Acb1 evade fusion with the vacuole to prevent cargo degradation. PMID: 20156967
  2. phospholipid biosynthesis gene expression is modulated either by the Acb1p-acyl-CoA ester complex directly or by its ability to donate acyl-CoA esters to utilizing systems. PMID: 17593018
  3. study of the cardiolipin species profile in Saccharomyces cerevisiae by using depletion of the acyl-CoA-binding protein Acb1p PMID: 19656950
Protein Families
ACBP family
Database Links

KEGG: sce:YGR037C

STRING: 4932.YGR037C

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*