Home
Protein
Recombinant Proteins
Recombinant Saccharomyces cerevisiae Cytosine deaminase (FCY1)

Recombinant Saccharomyces cerevisiae Cytosine deaminase (FCY1)

^{In Stock}

Code	CSB-EP613203SVG
Abbreviation	Recombinant Saccharomyces cerevisiae FCY1 protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

FCY1

Uniprot No.

Q12178

Research Area

Others

Alternative Names

FCY1; YPR062W; YP9499.17Cytosine deaminase; EC 3.5.4.1; Cytosine aminohydrolase

Species

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Source

E.coli

Expression Region

1-158aa

Target Protein Sequence

MVTGGMASKWDQKGMDIAYEEAALGYKEGGVPIGGCLINNKDGSVLGRGHNMRFQKGSATLHGEISTLENCGRLEGKVYKDTTLYTTLSPCDMCTGAIIMYGIPRCVVGENVNFKSKGEKYLQTRGHEVVVVDDERCKKIMKQFIDERPQDWFEDIGE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

25.0 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Catalyzes the hydrolytic deamination of cytosine to uracil or 5-methylcytosine to thymine. Is involved in the pyrimidine salvage pathway, which allows the cell to utilize cytosine for pyrimidine nucleotide synthesis.

Gene References into Functions

Cytosine deaminase residue glutamate64 plays a critical role in the activation of anticancer prodrug 5-fluorocytosine, indicating importance not only for the deamination reaction but also for binding of the substrate. PMID: 22208667

Subcellular Location

Cytoplasm. Nucleus.

Protein Families

Cytidine and deoxycytidylate deaminase family

Database Links

KEGG: sce:YPR062W

STRING: 4932.YPR062W

Promotions