Recombinant Salmonella typhimurium Outer membrane porin protein OmpD (ompD)

In Stock
Code CSB-EP334291SXB
Abbreviation Recombinant Salmonella typhimurium ompD protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP334291SXB could indicate that this peptide derived from E.coli-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) ompD.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP334291SXB could indicate that this peptide derived from E.coli-expressed Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) ompD.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ompD
Uniprot No.
Research Area
Others
Alternative Names
ompD; nmpC; STM1572; Outer membrane porin protein OmpD
Species
Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Source
E.coli
Expression Region
22-362aa
Target Protein Sequence
AEVYNKDGNKLDLYGKVHAQHYFSDDNGSDGDKTYARLGFKGETQINDQLTGFGQWEYEFKGNRTESQGADKDKTRLAFAGLKFADYGSFDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTGRTTGVATYRNTDFFGLVEGLNFAAQYQGKNDRDGAYESNGDGFGLSATYEYEGFGVGAAYAKSDRTNNQVKAASNLNAAGKNAEVWAAGLKYDANNIYLATTYSETLNMTTFGEDAAGDAFIANKTQNFEAVAQYQFDFGLRPSIAYLKSKGKNLGTYGDQDLVEYIDVGATYYFNKNMSTFVDYKINLLDDSDFTKAAKVSTDNIVAVGLNYQF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
53.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Salmonella typhimurium ompD contains amino acids 22-362. The theoretical molecular weight of the ompD protein is 53.6 kDa. The ompD protein was expressed in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of ompD, which enables a simple process of detecting and purifying the ompD recombinant protein in the following steps.

The outer membrane porin protein (OmpD) in Salmonella typhimurium is a key component of the bacterial outer membrane, contributing to the selective permeability and integrity of the cell envelope. OmpD functions as a porin, forming channels in the outer membrane that allow the passive diffusion of small hydrophilic molecules, including ions and nutrients, across the bacterial membrane. OmpD plays a crucial role in the uptake of essential nutrients from the external environment, such as sugars and amino acids, facilitating the bacterium's survival and growth. Additionally, OmpD is involved in the response to environmental stresses, including exposure to host immune defenses and antimicrobial agents. The protein contributes to the adaptability of Salmonella typhimurium in diverse host environments and is often implicated in the bacterial pathogenesis process. Understanding the structure and function of OmpD provides insights into the mechanisms of bacterial adaptation and virulence.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Forms pores that allow passive diffusion of small molecules across the outer membrane.
Subcellular Location
Cell outer membrane; Multi-pass membrane protein.
Protein Families
Gram-negative porin family
Database Links

KEGG: stm:STM1572

STRING: 99287.STM1572

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*