Recombinant Saxiphilin, partial for Lithobates catesbeiana, partial

In Stock
Code CSB-MP339158LQA
Abbreviation Recombinant Saxiphilin protein, partial for Lithobates catesbeiana protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Microbiology
Alternative Names
Saxiphilin; SAX
Species
Lithobates catesbeiana (American bullfrog) (Rana catesbeiana)
Source
Mammalian cell
Expression Region
484-844aa
Target Protein Sequence
AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.7kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Saxiphilin for Lithobates catesbeiana is produced in a mammalian cell expression system, which appears to ensure proper folding and post-translational modifications. This partial protein spans amino acids 484-844 and is tagged with an N-terminal 6xHis-Myc for ease of purification and detection. The product achieves a purity of over 90% as verified by SDS-PAGE, making it suitable for high-precision research applications.

Saxiphilin is a notable protein found in the American bullfrog, Lithobates catesbeiana, known for its role in binding saxitoxin, a potent neurotoxin. This protein plays an instrumental role in studies of toxin interactions and serves as a model for understanding binding mechanisms in toxin-related research. Its ability to bind saxitoxin makes it a key component in exploring toxin resistance and detoxification pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Saxiphilin is a complex eukaryotic protein that binds saxitoxin with high affinity and requires precise folding for its functional activity. The mammalian cell expression system provides the optimal environment for proper folding, post-translational modifications, and disulfide bond formation. However, this recombinant protein represents only a partial fragment (484-844aa) of the full-length protein, which may lack a complete structural context. While mammalian expression increases the probability of correct folding, the partial nature and presence of the N-terminal 6xHis-Myc tag require experimental validation to confirm functional activity.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

Protein-protein interactions depend on a precise tertiary structure that must be confirmed experimentally. 

If Correctly Folded (Verified): Highly suitable for identifying physiological binding partners involved in saxiphilin's biological functions. The mammalian expression ensures native-like interactions.

If Misfolded/Unverified: High risk of non-specific binding or failure to recognize genuine interaction partners. Results would be biologically misleading.

2. Antibody Development and Validation

Antibody development can proceed based on sequence, but conformation-specific antibodies require proper folding.

If Correctly Folded (Verified): Excellent for generating conformation-sensitive antibodies that recognize native saxiphilin epitopes.

If Misfolded/Unverified: Suitable for producing antibodies against linear epitopes, but these may not efficiently recognize the native protein structure.

3. Comparative Protein Structure and Function Analysis

Valid structural and functional comparisons require the protein to be in its native conformation. 

If Correctly Folded (Verified): Ideal for meaningful comparative studies with saxiphilin orthologs, providing insights into evolutionary adaptations.

If Misfolded/Unverified: Comparative analyses would yield misleading results, as structural differences would reflect misfolding rather than genuine evolutionary variations.

4. Tag-Based Immunoassay Development

Immunoassays primarily rely on sequence-specific antibody recognition rather than functional conformation.

If Correctly Folded (Verified): Highly suitable as a quantitative standard for detecting native saxiphilin in biological samples.

If Misfolded/Unverified: Can serve as an immunoassay standard for detecting immunoreactive material, but may not accurately measure functional saxiphilin levels.

Final Recommendation & Action Plan

The mammalian expression system provides a high probability of correct folding for this saxiphilin fragment, but the partial nature of the protein requires experimental validation before reliable use in functional studies. The immediate priority is to conduct biochemical and functional characterization to assess folding quality through techniques like size-exclusion chromatography with multi-angle light scattering (SEC-MALS) and functional saxitoxin-binding assays. If correct folding and binding activity are verified, proceed confidently with Applications 1, 2 (conformational antibodies), and 3 for interaction studies, antibody development, and comparative analyses. If misfolding is detected, limit applications to linear epitope antibody production (Application 2) and use as an immunoassay standard (Application 4). For all applications involving functional studies, include appropriate controls and validation steps to ensure data reliability. This systematic approach ensures appropriate use based on experimental validation of protein folding and functional competence.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds specifically to the neurotoxin saxitoxin. Its physiological role may be to transport or sequester an endogenous organic molecule other than Fe(3+). It may participate in a detoxification mechanism for neutralizing a microbial toxin.
Subcellular Location
Secreted.
Protein Families
Transferrin family
Tissue Specificity
Plasma. Highest levels of transcripts found in the liver, the lung, the pancreas and the brain.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*