Recombinant Staphylococcus aureus 30 kDa neutral phosphatase, partial

In Stock
Code CSB-EP324148FKZ
Abbreviation Recombinant Staphylococcus aureus 30 kDa neutral phosphatase protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Microbiology
Alternative Names
30 kDa neutral phosphatase; NPTase; EC 3.1.-.-; Fragment
Species
Staphylococcus aureus
Source
E.coli
Expression Region
1-35aa
Target Protein Sequence
KSSAEVQQTQQASIPASQKANLGNQNNIMSVASYQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.7kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Staphylococcus aureus 30 kDa neutral phosphatase gets produced in E.coli and comes with an N-terminal 6xHis-SUMO tag that helps with purification and appears to boost stability. This partial protein covers the 1-35 amino acid region and reaches over 90% purity, which SDS-PAGE analysis confirms. It's designed strictly for research purposes and seems to offer a dependable, high-quality choice for studies that need this particular phosphatase.

The 30 kDa neutral phosphatase from Staphylococcus aureus is an enzyme that likely plays a key role in phosphate metabolism. Phosphatases are important for many cellular processes - signal transduction and energy metabolism among them - by removing phosphate groups from substrates. Studying this enzyme may provide insights into bacterial physiology and potential interactions within host environments. This makes it a potentially valuable tool in microbiological and biochemical research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Staphylococcus aureus 30 kDa neutral phosphatase is a bacterial enzyme that requires precise folding, proper active site formation, and specific tertiary structure for its functional phosphatase activity. The E. coli expression system is homologous to this bacterial protein, which increases the probability of correct folding. However, the partial fragment (1-35aa) represents only a small N-terminal portion of the full-length protein and lacks critical catalytic domains essential for enzymatic activity. The large N-terminal 6xHis-SUMO tag (∼15 kDa) is significantly larger than the protein fragment itself (∼4 kDa), creating severe steric interference that will completely disrupt any potential functional domains. The probability of correct folding with functional phosphatase activity is essentially zero.

1. Antibody Development and Epitope Mapping

This application has severe limitations. While antibodies can be generated, the immune response will primarily target the large foreign SUMO tag rather than the small phosphatase fragment. Antibodies may not recognize the full-length, properly folded phosphatase in its native context.

2. Structural and Biochemical Characterization Studies

Basic biophysical analysis can be performed but will primarily reflect SUMO tag properties rather than phosphatase structure. The 35aa fragment is too short to form any meaningful phosphatase domain structure. Results will describe a tag-dominated protein rather than native phosphatase characteristics.

Final Recommendation & Action Plan

This SUMO-tagged phosphatase fragment is fundamentally unsuitable for any meaningful phosphatase research due to the extreme size disparity between the tag (15 kDa) and the protein fragment (4 kDa). The SUMO tag is nearly four times larger than the phosphatase fragment itself, making all functional and interaction studies biologically irrelevant. The only limited application is generating tag-specific antibodies (Application 1 with severe limitations). Avoid all interaction, structural, and binding studies entirely. For reliable phosphatase research, use full-length protein constructs that contain the complete catalytic domain and functional regions, preferably with minimal tags to preserve native structure and function.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Highly cationic enzyme that can bind human or rat immunoglobulins as well as serum albumin, and could therefore be involved in post-infectious sequelae.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*