Recombinant Staphylococcus aureus Staphopain A (sspP)

In Stock Promotion
Code CSB-EP305573FKZ
Abbreviation Recombinant Staphylococcus aureus sspP protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
sspP
Uniprot No.
Research Area
Cell Biology
Alternative Names
(Staphylococcal cysteine proteinase A)(Staphylopain A)
Species
Staphylococcus aureus
Source
E.coli
Expression Region
215-388aa
Target Protein Sequence
YNEQYVNKLENFKIRETQGNNGWCAGYTMSALLNATYNTNKYHAEAVMRFLHPNLQGQQFQFTGLTPREMIYFEQTQGRSPQLLNRMTTYNEVDNLTKNNKGIAILGSRVESRNGMHAGHAMAVVGNAKLNNGQEVIIIWNPWDNGFMTQDAKNNVIPVSNGDHYQWYSSIYGY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Staphylococcus aureus Staphopain A (sspP) gets expressed in E. coli and includes the complete mature protein sequence (215-388aa). The product comes with two tags that make purification and detection much simpler: a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. SDS-PAGE analysis shows purity levels above 90%, which appears to make this a reliable reagent for research work.

Staphopain A is a cysteine protease that comes from Staphylococcus aureus. It likely plays a key role in how the bacteria cause disease. The enzyme breaks down host proteins, which may help the bacteria evade immune responses and invade tissues. This makes the protein a useful tool for researchers studying how bacteria cause infections and how they interact with their hosts.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Staphylococcus aureus Staphopain A is expressed in E. coli, a prokaryotic system that is generally suitable for producing bacterial proteins like this cysteine protease. Staphopain A requires precise folding with proper disulfide bond formation for its proteolytic activity, and E. coli can typically handle the folding requirements for bacterial proteins. The protein is expressed as the mature region (62-380aa) with dual tags (N-terminal 10xHis and C-terminal Myc), which may affect the natural structure but likely preserves core functionality. The >90% purity indicates good production quality. However, since activity is unverified and cysteine proteases require specific folding for their catalytic triad formation, the protein cannot be assumed to be correctly folded or bioactive without experimental validation of its proteolytic activity.

1. Antibody Development and Immunoassay Optimization

This application is appropriate. The recombinant Staphopain A can serve as an effective immunogen for generating antibodies that recognize linear epitopes. The dual tags provide additional options for detection and purification. The high purity supports immunization protocols. However, if the protein is misfolded, antibodies may not recognize conformational epitopes of native Staphopain A. Validation against native protease from S. aureus is recommended.

2. Protein-Protein Interaction Studies Using Tag-Assisted Pull-Down Assays

This application requires caution. While the tags enable technical feasibility for pull-down assays, if Staphopain A is misfolded, it may not interact physiologically with its true substrates or regulators. The catalytic site requires precise conformation for specific interactions. This application should only be pursued after confirming proper folding and proteolytic activity.

3. Biochemical Characterization and Substrate Specificity Analysis

This application is well-suited but requires activity validation first. Basic biochemical studies are feasible, but substrate specificity assays are only valid if the protease is properly folded and active. These studies should include validation of proteolytic activity using known substrates before interpreting specificity data.

4. Comparative Protease Studies and Inhibitor Screening

This application is valuable but highly dependent on correct folding. If Staphopain A is misfolded, comparative studies with other proteases will yield invalid results, and inhibitor screening may identify compounds that target non-physiological conformations. This requires prior validation of proper folding and enzymatic activity.

Final Recommendation & Action Plan

Given that this is a bacterial protein expressed in its native prokaryotic system, the likelihood of proper folding is higher than for eukaryotic proteins. However, recommend first validating proteolytic activity using known Staphopain A substrates (such as specific peptide sequences or protein substrates that this protease cleaves). Perform basic biophysical characterization (size-exclusion chromatography, circular dichroism) to assess folding quality. Antibody development can proceed as the safest application. Protease activity assays and interaction studies should await proper activity validation. For reliable functional studies, always include appropriate controls such as known substrates and specific inhibitors.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cysteine protease that plays an important role in the inhibition of host innate immune response. Cleaves host elastins found in connective tissues, pulmonary surfactant protein A in the lungs, and the chemokine receptor CXCR2 on leukocytes. Proteolytic cleavage of surfactant protein A impairs bacterial phagocytocis by neutrophils while CXCR2 degradation blocks neutrophil activation and chemotaxis. Additionally, promotes vascular leakage by activating the plasma kallikerin/kinin system, resulting in hypotension.
Subcellular Location
Secreted.
Protein Families
Peptidase C47 family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*