Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1

In Stock
Code CSB-BP323347TON
Abbreviation Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1 protein
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
; Beta-mammal/insect toxin Ts1; PT-Mice-Ins-beta NaTx6.1; Tityustoxin VII; Ts VII; Ts7; TsTX-VII; Toxin II-11; Toxin III-10; Toxin T2-IV; Toxin gamma; TsTX-I
Species
Tityus serrulatus (Brazilian scorpion)
Source
Baculovirus
Expression Region
21-81aa
Target Protein Sequence
KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
10.8
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1 is produced through a baculovirus expression system and includes the complete mature protein sequence spanning amino acids 21 to 81. The protein carries an N-terminal 10xHis-tag along with a C-terminal Myc-tag, which help streamline purification and detection processes. SDS-PAGE analysis shows the protein achieves greater than 85% purity, delivering what appears to be high-quality material for research work.

The Tityus serrulatus Beta-mammal/insect toxin Ts1 represents a well-characterized element of scorpion venom that targets ion channels with notable specificity. Researchers primarily turn to this protein when investigating ion channel modulation mechanisms, as it may provide valuable insights into neurophysiological processes and potential therapeutic targets. Its study seems particularly important in toxicology and pharmacology research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Tityus serrulatus Beta-mammal/insect toxin Ts1 is a small scorpion toxin (21-81aa) that requires precise folding, proper disulfide bond formation (typically 3-4 disulfide bonds), and specific tertiary structure for its ion channel binding activity. The baculovirus-insect cell expression system provides a eukaryotic environment that supports proper protein folding and disulfide bond formation, which is crucial for this toxin's structural integrity. However, the dual N-terminal 10xHis-tag and C-terminal Myc-tag are relatively large compared to the small toxin size (∼7 kDa mature protein), potentially causing significant steric interference with the toxin's functional domains and binding interfaces. While the expression system favors correct disulfide bonding, the protein's folding status and functional capability should be validated before its use in various applications.

1. Ion Channel Interaction Studies

This application carries a high risk due to potential structural interference from the dual tags. Ts1's ion channel binding requires precise three-dimensional structure formation with specific disulfide bonding. The large tags (∼15 kDa combined) relative to the small toxin (∼7 kDa) may sterically block binding sites or alter conformational dynamics. If correctly folded and functionally validated (verified), limited qualitative studies may be possible. If unverified, electrophysiological results will be unreliable for determining true binding characteristics.

2. Antibody Development and Immunoassay Applications

This application is highly suitable as antibody generation depends on linear epitope availability. The full-length mature toxin provides complete antigenic coverage, and the dual tags offer additional epitopes for antibody screening. While the tags may alter some conformational epitopes, the core toxin sequence remains available for generating specific antibodies against native Ts1 epitopes.

3. Structure-Function Relationship Studies

This application requires careful interpretation due to tag interference. While comparative studies with mutant variants are possible, the tags may mask or alter structure-activity relationships. Meaningful functional comparisons require tag-free constructs to avoid confounding effects on toxin function and binding characteristics.

4. Biochemical Characterization and Stability Studies

These studies are essential priority applications for assessing folding quality. Techniques should focus on disulfide bond analysis (mass spectrometry), circular dichroism spectroscopy to evaluate secondary structure, and thermal stability assays. However, results will reflect the tagged protein's properties rather than the native toxin's characteristics.

Final Recommendation & Action Plan

The baculovirus system provides favorable disulfide bond formation capabilities for this scorpion toxin, but the large dual-tag configuration relative to the small toxin size creates a significant risk of structural distortion and functional impairment. Begin with Application 4 (Biochemical Characterization) to assess disulfide bonding patterns and structural integrity. Applications 2 (Antibody Development) can proceed immediately. Protein-protein interaction screening studies are not recommended due to the high probability of structural distortion. For Applications 1 and 3 (Ion Channel Studies and Structure-Function), first validate functionality with known ion channel targets and compare results with tag-free toxin constructs. Given the size disparity between tags and toxin, consider using tag-free constructs for all functional studies requiring native toxin activity.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Voltage-gated sodium channels (Nav) gating-modifier. Acts both as alpha- and beta-toxin, since it affects not only activation but also inactivation of Nav channels (Probable). Binds to Nav domain DII and impairs the four Nav channel voltage sensors movements. Depending on Nav channel subtypes tested, can also bind Nav domains DIII (low affinity) and DIV (very low affinity). Acts on almost all the Nav channels tested (mammalian Nav1.2/SCN2A, Nav1.3/SCN3A, Nav1.4/SCN4A, Nav1.5/SCN5A, Nav1.6/SCN8A, Nav1.9/SCN11A, and insect DmNav1). Is highly active against both mammals and insects. Irreversibly modulates DmNav channels. Other Ts1 activities have been studied, such as immunomodulation, antimicrobial activity or exocrine secretion (Probable). This toxin exhibits an antifungal activity against filamentous fungi. In vitro, it has an important immunomodulatory effect on macrophages by stimulating the release of proinflammatory cytokines. It also shows an activity in exocrine secretion in pancreas, stomach and adrenal gland.
Subcellular Location
Secreted.
Protein Families
Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily
Tissue Specificity
Expressed by the venom gland.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*