Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1

In Stock
Code CSB-BP323347TON
Abbreviation Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1 protein
MSDS
Size $528
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
; Beta-mammal/insect toxin Ts1; PT-Mice-Ins-beta NaTx6.1; Tityustoxin VII; Ts VII; Ts7; TsTX-VII; Toxin II-11; Toxin III-10; Toxin T2-IV; Toxin gamma; TsTX-I
Species
Tityus serrulatus (Brazilian scorpion)
Source
Baculovirus
Expression Region
21-81aa
Target Protein Sequence
KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
10.8
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1 is produced through a baculovirus expression system and includes the complete mature protein sequence spanning amino acids 21 to 81. The protein carries an N-terminal 10xHis-tag along with a C-terminal Myc-tag, which help streamline purification and detection processes. SDS-PAGE analysis shows the protein achieves greater than 85% purity, delivering what appears to be high-quality material for research work.

The Tityus serrulatus Beta-mammal/insect toxin Ts1 represents a well-characterized element of scorpion venom that targets ion channels with notable specificity. Researchers primarily turn to this protein when investigating ion channel modulation mechanisms, as it may provide valuable insights into neurophysiological processes and potential therapeutic targets. Its study seems particularly important in toxicology and pharmacology research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Ion Channel Interaction Studies

This recombinant Ts1 toxin works well in electrophysiological assays designed to examine its binding affinity and specificity for different ion channels, especially sodium and potassium channels. The His and Myc tags make purification and detection straightforward in patch-clamp experiments or voltage-clamp studies that use heterologously expressed ion channels. Scientists can generate dose-response curves to calculate IC50 values and map out the toxin's selectivity profile across various channel subtypes. The high purity level (>85%) likely ensures consistent and reproducible results in these delicate biophysical measurements.

2. Antibody Development and Immunoassay Applications

The dual-tagged recombinant Ts1 protein makes an effective immunogen for creating specific antibodies against this scorpion toxin. Its N-terminal His tag simplifies purification for immunization protocols, while the C-terminal Myc tag offers a useful epitope for detection and validation of antibody specificity. Scientists can build ELISA-based assays using anti-His or anti-Myc antibodies as capture or detection tools to examine toxin-antibody interactions and cross-reactivity patterns.

3. Protein-Protein Interaction Screening

His-tagged Ts1 can be attached to nickel-affinity matrices for pull-down assays aimed at identifying new cellular binding partners or membrane receptors. This method allows scientists to screen cell lysates or membrane preparations to uncover previously unknown molecular targets of this scorpion toxin. The Myc tag serves as an additional tool for Western blot detection and validation of captured protein complexes.

4. Structure-Function Relationship Studies

This recombinant toxin serves as a reference standard in comparative studies alongside mutant variants or related toxins from similar scorpion species. Scientists can conduct binding competition assays or functional studies to identify critical amino acid residues that drive toxin activity and specificity. The baculovirus system's consistent expression patterns appear to ensure reliable protein folding and post-translational modifications for dependable structure-activity comparisons.

5. Biochemical Characterization and Stability Studies

The purified recombinant Ts1 makes detailed biochemical analysis possible, including thermal stability, pH sensitivity, and proteolytic resistance studies. Scientists can track protein integrity and degradation patterns under different experimental conditions using the dual tags as monitoring tools. These studies may offer fundamental insights into the toxin's biophysical properties and help determine optimal storage and handling conditions for research applications.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Voltage-gated sodium channels (Nav) gating-modifier. Acts both as alpha- and beta-toxin, since it affects not only activation but also inactivation of Nav channels (Probable). Binds to Nav domain DII and impairs the four Nav channel voltage sensors movements. Depending on Nav channel subtypes tested, can also bind Nav domains DIII (low affinity) and DIV (very low affinity). Acts on almost all the Nav channels tested (mammalian Nav1.2/SCN2A, Nav1.3/SCN3A, Nav1.4/SCN4A, Nav1.5/SCN5A, Nav1.6/SCN8A, Nav1.9/SCN11A, and insect DmNav1). Is highly active against both mammals and insects. Irreversibly modulates DmNav channels. Other Ts1 activities have been studied, such as immunomodulation, antimicrobial activity or exocrine secretion (Probable). This toxin exhibits an antifungal activity against filamentous fungi. In vitro, it has an important immunomodulatory effect on macrophages by stimulating the release of proinflammatory cytokines. It also shows an activity in exocrine secretion in pancreas, stomach and adrenal gland.
Subcellular Location
Secreted.
Protein Families
Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily
Tissue Specificity
Expressed by the venom gland.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*