Recombinant Tityus zulianus Beta-toxin Tz1

In Stock
Code CSB-EP649921TAAJ
Abbreviation Recombinant Tityus zulianus Beta-toxin Tz1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
Beta-toxin Tz1; PT-beta NaTx14.1
Species
Tityus zulianus(Venezuelan scorpion)
Source
E.coli
Expression Region
21-84aa
Target Protein Sequence
KDGYLVGNDGCKYSCFTRPGTYCANECSRVKGKDGYCYAWMACYCYSMPNWVKTWDRATNRCGR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Tityus zulianus Beta-toxin Tz1 gets expressed in E. coli and covers the complete mature protein sequence from amino acids 21 to 84. The protein comes engineered with an N-terminal 10xHis-tag and a C-terminal Myc-tag, which makes purification and detection much more straightforward. SDS-PAGE analysis shows it reaches over 85% purity - a level that appears suitable for research applications demanding high-quality protein preparations.

Beta-toxin Tz1 from Tityus zulianus is a fairly well-characterized peptide that's known to mess with ion channel activity, especially sodium channels. Being a scorpion toxin, it has become quite important in neurophysiological research. Scientists rely on it to better understand how ion channels work and interact with other molecules. The toxin's distinctive properties may make it a valuable tool for anyone digging into ion channel regulation mechanisms and neurotoxicology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Tityus zulianus Beta-toxin Tz1 is a scorpion toxin that requires precise folding, proper disulfide bond formation (typically 3-4 conserved disulfide bonds), and specific tertiary structure for its functional activity in ion channel binding and modulation. The E. coli expression system cannot provide the optimal eukaryotic folding environment or oxidative conditions for correct disulfide bond formation. The dual N-terminal 10xHis-tag and C-terminal Myc-tag are relatively large compared to the small toxin size (∼7 kDa mature protein), potentially causing significant steric interference with the toxin's functional domains and ion channel binding interfaces. While the protein may be soluble, the probability of correct folding with functional ion channel activity is low.

1. Antibody Development and Immunological Research

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional protein folding. The full-length mature toxin provides complete epitope coverage for generating antibodies against Tz1. The high purity (>90%) ensures minimal contamination-related issues during immunization protocols.

2. Biophysical Characterization Studies

Basic biophysical characterization can be performed but will not reflect native toxin structure. Techniques like circular dichroism spectroscopy may detect secondary structure but cannot verify functional disulfide bonding. The large tags will dominate the protein's behavior in analytical techniques, masking the native toxin's characteristics. Structural biology techniques requiring native folding will not yield meaningful results.

Final Recommendation & Action Plan

This dual-tagged Tz1 toxin construct is fundamentally unsuitable for functional studies due to the severe steric interference caused by the large tags relative to the small toxin size. The tags (∼11 kDa combined) are larger than the toxin itself (∼7 kDa) and will physically block ion channel binding sites. The only suitable application is antibody development. Application 2 can provide basic physical characterization but will not reflect native toxin properties. For reliable Tz1 research requiring functional activity, use tag-free toxin produced by chemical synthesis or eukaryotic expression systems that support proper disulfide bond formation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Beta toxins bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. Strongly affects skeletal muscle channels Nav1.4/SCN4A, poorly affects the neuronal channels Nav1.6/SCN8A and Nav1.2/SCN2A. Induces spastic paralysis of rear limbs, increased salivation, apnea, tachycardia and increased perspiration.
Subcellular Location
Secreted.
Protein Families
Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily
Tissue Specificity
Expressed by the venom gland.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*