Recombinant Ceratopteris richardii Cyanovirin-N homolog

In Stock
Code CSB-YP309974CGP
Abbreviation Recombinant Ceratopteris richardii Cyanovirin-N homolog protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP309974CGP could indicate that this peptide derived from Yeast-expressed Ceratopteris richardii (Triangle waterfern) Cyanovirin-N homolog.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP309974CGP could indicate that this peptide derived from Yeast-expressed Ceratopteris richardii (Triangle waterfern) Cyanovirin-N homolog.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
Cyanovirin-N homolog; CV-N homolog
Species
Ceratopteris richardii (Triangle waterfern)
Source
Yeast
Expression Region
28-142aa
Target Protein Sequence
QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Ceratopteris richardii Cyanovirin-N homolog gets expressed in a yeast system and includes the full mature protein from amino acids 28 to 142. The product comes with an N-terminal 6xHis-tag that makes purification and detection more straightforward. SDS-PAGE analysis shows it reaches a purity level greater than 90%, which appears suitable for various research applications. This protein is meant for research use only and isn't intended for therapeutic or diagnostic purposes.

Cyanovirin-N homolog is a protein that seems particularly good at binding specific sugar molecules—a property that may influence various biological processes. Scientists study proteins in the Cyanovirin-N family mainly for their roles in carbohydrate recognition and binding pathways. This makes them quite interesting for research areas that focus on molecular interactions and the development of new biotechnological applications.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant Ceratopteris richardii Cyanovirin-N homolog is produced in a yeast expression system as the full-length mature protein (28-142aa) with an N-terminal 6xHis-tag. Cyanovirin-N homologs are lectin proteins that require precise folding and disulfide bond formation for their carbohydrate-binding activity. Yeast expression systems provide eukaryotic folding machinery capable of supporting disulfide bond formation, which is critical for this protein's structural integrity. The full-length mature protein increases the probability of correct folding. However, the N-terminal His-tag may potentially interfere with protein function or folding. Purity >90% by SDS-PAGE is determined under denaturing conditions and does not confirm native folding or bioactivity. No validation data (e.g., carbohydrate binding assays, circular dichroism) are provided. Therefore, while yeast expression offers advantages for proper folding, the protein's structural and functional integrity cannot be confirmed without experimental validation.

1. Lectin-Carbohydrate Interaction Studies

Lectin function depends on a precise three-dimensional structure; misfolding would compromise carbohydrate recognition. If correctly folded, this recombinant protein can be used to study carbohydrate binding specificity and affinity through techniques like glycan array screening or surface plasmon resonance. However, if misfolded, the carbohydrate-binding domains may be disrupted, leading to invalid binding data and incorrect evolutionary comparisons with other cyanovirin-N proteins.

2. Protein-Protein Interaction Mapping

Protein-protein interactions require native conformation; structural defects would yield misleading interaction networks. If properly folded, the His-tagged protein can be used in pull-down assays to identify biological interaction partners. However, if misfolded, interaction domains may be altered, resulting in non-specific binding or failure to identify genuine partners in fern biology.

3. Structural and Biophysical Characterization

Structural studies require proper folding to generate biologically relevant data. If correctly folded, the protein is suitable for structural studies like X-ray crystallography or NMR, and biophysical analysis like circular dichroism. However, if misfolded, structural data would misrepresent the native protein's architecture, leading to erroneous structure-function insights.

4. Antibody Development and Immunoassay Applications

Antibodies can be generated against linear sequences even in misfolded proteins, but may lack specificity for native conformation. This application is suitable, as antibody generation primarily relies on linear epitope recognition. However, if misfolded, antibodies may not optimally recognize conformational epitopes of the native protein in biological contexts.

Final Recommendation & Action Plan

Before employing this recombinant protein in functional studies, validate its folding and bioactivity through biophysical methods (circular dichroism for secondary structure, disulfide bond analysis) and functional assays (carbohydrate binding tests); if validation confirms proper folding, proceed with applications while considering potential tag interference; if misfolded, consider tag removal or alternative expression systems; antibody development can proceed immediately but validate antibodies against native protein; always include appropriate controls (e.g., known lectins, binding standards) in experiments to ensure reliability. For structural studies, consider removing the His-tag to avoid interference with protein crystallization or NMR analysis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I want to know ETA on this protein CSB-YP309974CGP / RPC20424 and if there are any publications on it. I am worried it might not have biological activity.

A:
Thanks for your inquiry.
This protein is the mature full length protein, it have activity in theory. We haven't verify it and we are not guarantee about the activity. Pls refer to:
http://www.uniprot.org/uniprot/P86326

Target Background

Function
Mannose-binding lectin.
Protein Families
Cyanovirin-N family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*