Recombinant Ceratopteris richardii Cyanovirin-N homolog

In Stock
Code CSB-YP309974CGP
Abbreviation Recombinant Ceratopteris richardii Cyanovirin-N homolog protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP309974CGP could indicate that this peptide derived from Yeast-expressed Ceratopteris richardii (Triangle waterfern) Cyanovirin-N homolog.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP309974CGP could indicate that this peptide derived from Yeast-expressed Ceratopteris richardii (Triangle waterfern) Cyanovirin-N homolog.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
Cyanovirin-N homolog; CV-N homolog
Species
Ceratopteris richardii (Triangle waterfern)
Source
Yeast
Expression Region
28-142aa
Target Protein Sequence
QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.4kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Ceratopteris richardii Cyanovirin-N homolog gets expressed in a yeast system and includes the full mature protein from amino acids 28 to 142. The product comes with an N-terminal 6xHis-tag that makes purification and detection more straightforward. SDS-PAGE analysis shows it reaches a purity level greater than 90%, which appears suitable for various research applications. This protein is meant for research use only and isn't intended for therapeutic or diagnostic purposes.

Cyanovirin-N homolog is a protein that seems particularly good at binding specific sugar molecules—a property that may influence various biological processes. Scientists study proteins in the Cyanovirin-N family mainly for their roles in carbohydrate recognition and binding pathways. This makes them quite interesting for research areas that focus on molecular interactions and the development of new biotechnological applications.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Lectin-Carbohydrate Interaction Studies

Researchers can use this recombinant protein to investigate how cyanovirin-N homologs from plant species bind carbohydrates. The N-terminal 6xHis tag allows for purification and immobilization in glycan array screening or surface plasmon resonance experiments. Scientists might compare how this fern-derived homolog binds compared to known cyanovirin-N proteins, which could help us understand how lectin domains have stayed conserved through evolution. The high purity (>90%) likely makes it suitable for quantitative binding assays and kinetic measurements.

2. Protein-Protein Interaction Mapping

That 6xHis tag makes pull-down assays much easier when researchers want to identify potential binding partners of this cyanovirin-N homolog in plant cell lysates or recombinant protein libraries. Co-immunoprecipitation experiments can work with anti-His antibodies to capture protein complexes. Since it's recombinant, researchers get controlled interaction studies without interference from other cellular components. This approach might reveal novel protein networks involving cyanovirin-N-like proteins in fern biology—though that remains to be seen.

3. Structural and Biophysical Characterization

The purified recombinant protein provides material for structural studies like X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy. Techniques such as circular dichroism spectroscopy can assess secondary structure content and thermal stability. Yeast expression systems typically produce properly folded eukaryotic proteins that work well for structural analysis. Comparing structures with other cyanovirin-N family members could illuminate structure-function relationships across species.

4. Antibody Development and Immunoassay Applications

This recombinant protein can work as an immunogen for generating polyclonal or monoclonal antibodies specific to Ceratopteris richardii cyanovirin-N homolog. The 6xHis tag allows development of sandwich ELISA formats using anti-His detection antibodies. Generated antibodies could then be used for Western blotting, immunofluorescence, or immunohistochemistry studies in fern tissues. The high purity should minimize cross-reactivity during antibody production and subsequent immunoassays.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I want to know ETA on this protein CSB-YP309974CGP / RPC20424 and if there are any publications on it. I am worried it might not have biological activity.

A:
Thanks for your inquiry.
This protein is the mature full length protein, it have activity in theory. We haven't verify it and we are not guarantee about the activity. Pls refer to:
http://www.uniprot.org/uniprot/P86326

Target Background

Function
Mannose-binding lectin.
Protein Families
Cyanovirin-N family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*