Home
Protein
Recombinant Protein
Recombinant Ceratopteris richardii Cyanovirin-N homolog

Recombinant Ceratopteris richardii Cyanovirin-N homolog

^{In Stock}

Code	CSB-YP309974CGP
MSDS	MSDS
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP309974CGP could indicate that this peptide derived from Yeast-expressed Ceratopteris richardii (Triangle waterfern) Cyanovirin-N homolog. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP309974CGP could indicate that this peptide derived from Yeast-expressed Ceratopteris richardii (Triangle waterfern) Cyanovirin-N homolog.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

N/A

Uniprot No.

P86326

Research Area

Others

Alternative Names

Cyanovirin-N homolog; CV-N homolog

Species

Ceratopteris richardii (Triangle waterfern)

Source

Yeast

Expression Region

28-142aa

Target Protein Sequence

QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

14.4kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I want to know ETA on this protein CSB-YP309974CGP / RPC20424 and if there are any publications on it. I am worried it might not have biological activity.

Thanks for your inquiry.
This protein is the mature full length protein, it have activity in theory. We haven't verify it and we are not guarantee about the activity. Pls refer to:
http://www.uniprot.org/uniprot/P86326