Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin

In Stock
Code CSB-EP357829TIFb0
Product Type Recombinant Protein
Size US$2466
Uniprot No. P09989
Lead Time 3-7 business days
Storage Buffer Tris-based buffer,50% glycerol
Species Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
Research Area Others
Source E.coli
Expression Region 24-270aa
Tag Info N-terminal 10xHis-tagged
Mol. Weight 30.8 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inactivates eukaryotic 60S ribosomal subunits.
Protein Families Ribosome-inactivating protein family, Type 1 RIP subfamily

Related Products

Antibodies

Antibodies for Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)

Proteins

Proteins for Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.