Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin

In Stock
Code CSB-EP357829TIFb0
Abbreviation Recombinant Trichosanthes kirilowii rRNA N-glycosidase protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
Ribosome-inactivating protein alpha-trichosanthin; Alpha-TCS; EC 3.2.2.22; rRNA N-glycosidase
Species
Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)
Source
E.coli
Expression Region
24-270aa
Target Protein Sequence
DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin is produced using an E. coli expression system and carries an N-terminal 10xHis tag. This protein contains the complete mature sequence from amino acids 24-270. SDS-PAGE analysis indicates the product reaches greater than 90% purity, which appears to meet quality standards for research use.

Alpha-trichosanthin comes from Trichosanthes kirilowii and is recognized for its capacity to shut down protein synthesis through ribosome inactivation. The mechanism involves removing a specific adenine base from ribosomal RNA—a modification that seems critical for its research applications in protein synthesis regulation. Scientists often turn to this protein when studying ribosome structure and function, though the complexity of these systems means results may vary.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Trichosanthes kirilowii alpha-trichosanthin is a ribosome-inactivating protein that requires precise folding, proper disulfide bond formation (with multiple conserved disulfide bonds), and specific active site conformation for its N-glycosidase activity. The E. coli expression system cannot provide the eukaryotic oxidative environment for correct disulfide bond formation. The N-terminal 10xHis-tag may sterically interfere with the protein's functional domains. While the mature protein region (24-270aa) contains the catalytic domain, the probability of correct folding with functional ribosome-inactivating activity requires experimental validation of disulfide bond formation and enzymatic activity.

1. Ribosome-Inactivating Protein Biochemical Characterization

This application carries a significant risk without functional validation. Trichosanthin's enzymatic activity requires precise disulfide bond formation and proper active site conformation. If correctly folded and active (verified through rRNA depurination assays), the protein may be suitable for kinetic studies. If misfolded/inactive (unverified), enzymatic measurements will yield biologically meaningless results.

2. Protein-Protein Interaction Studies

This application requires proper folding validation. Trichosanthin interactions with ribosomal proteins require precise tertiary structure and correct disulfide bonding. If correctly folded (verified), the protein may identify physiological interaction partners. If misfolded/unverified, there is a high risk of non-specific binding or failure to replicate genuine ribosomal interactions.

3. Antibody Development and Validation

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional enzymatic activity. The full-length mature protein provides comprehensive epitope coverage for generating trichosanthin-specific antibodies. The high purity (>90%) ensures minimal contamination-related issues during immunization protocols.

4. Structural and Biophysical Analysis

These studies are essential for determining folding status. Techniques should include circular dichroism spectroscopy to assess secondary structure, size-exclusion chromatography to evaluate oligomeric state, and disulfide bond analysis. However, the His-tag may interfere with high-resolution structural studies and functional domain accessibility.

Final Recommendation & Action Plan

The E. coli-expressed trichosanthin with His-tag may not be properly folded for functional applications due to the lack of eukaryotic disulfide bond formation machinery. Begin with Application 4 (Structural Characterization) to assess folding quality through CD spectroscopy, SEC, and validate enzymatic activity using rRNA depurination assays before considering functional applications. Applications 1 and 2 require rigorous functional validation. Application 3 (antibody development) can proceed immediately. For reliable trichosanthin research requiring native functionality, use eukaryotic expression systems that support proper disulfide bond formation, or implement refolding protocols with extensive activity validation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inactivates eukaryotic 60S ribosomal subunits.
Protein Families
Ribosome-inactivating protein family, Type 1 RIP subfamily
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*