Recombinant Triticum aestivum Trypsin/alpha-amylase inhibitor CMx2

In Stock
Code CSB-EP674868TQN
Abbreviation Recombinant Triticum aestivum Trypsin/alpha-amylase inhibitor CMx2 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Uniprot No.
Research Area
others
Alternative Names
Trypsin/alpha-amylase inhibitor CMX2; ITRL-2
Species
Triticum aestivum (Wheat)
Source
E.coli
Expression Region
25-121aa
Target Protein Sequence
FREQCVPGREITYESLNARREYAVRQTCGYYLSAERQKRRCCDELSKVPELCWCEVLRILMDRRVTKEGVVKDSLLQDMSRCKKLTREFIAGIVGRE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.5kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Triticum aestivum Trypsilpha-amylase inhibitor CMx2 is expressed in E.coli, covering the full length of the mature protein from amino acids 25 to 121. This recombinant protein features an N-terminal 10xHis-SUMO tag and a C-terminal Myc tag, which appears to enhance solubility and detection. The purity exceeds 85% as determined by SDS-PAGE, making this product suitable for research applications that require high-quality protein samples.

Trypsilpha-amylase inhibitor CMx2 comes from wheat and seems to play an important role in blocking specific amylase enzymes. This blocking action may be significant when studying how enzymes are controlled and how proteins interact within different biological pathways. Its distinctive properties likely make it a useful tool for research into enzyme activity and regulation, potentially offering insights into biochemical processes and applications in biotechnology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Triticum aestivum Trypsin/alpha-amylase inhibitor CMx2 is a plant protein that requires precise disulfide bond formation and proper tertiary structure for its inhibitory activity against trypsin and alpha-amylase. The E. coli expression system cannot perform the necessary post-translational modifications (particularly proper disulfide bonding) that are critical for this protein's native conformation. The dual N-terminal His-SUMO tag (∼20 kDa) and C-terminal Myc tag may sterically interfere with the protein's active sites and proper folding. While the protein may be soluble, it is highly unlikely to achieve the correct folding needed for functional inhibitory activity. 

1. Antibody Development and Validation Platform

This recombinant protein serves as an excellent immunogen for generating antibodies against linear epitopes of the wheat inhibitor. The mature protein sequence ensures comprehensive epitope coverage. The dual tags facilitate purification and provide additional epitopes for screening. However, antibodies may not efficiently recognize conformational epitopes on the native, properly folded inhibitor.

2. Comparative Biochemical Characterization Studies

This is the essential first step to assess the protein's physical properties. Basic biophysical characterization is valuable for quality control, but functional studies are not feasible without proper folding. Techniques like circular dichroism can analyze secondary structure content, while size-exclusion chromatography can determine oligomeric state and homogeneity. However, functional inhibitory assays will likely yield negative results due to probable misfolding.

3. Tag-Based Detection Method Development

This protein is well-suited for developing and optimizing detection methods that leverage the dual tags. The His and Myc tags enable sandwich ELISA protocols, Western blot optimization, and other immunoassay developments that depend on tag recognition rather than protein function.

Final Recommendation & Action Plan

This dual-tagged recombinant inhibitor is primarily suitable for antibody development and tag-based detection applications, but fundamentally unsuitable for functional studies due to E. coli's inability to produce properly folded plant protein with correct disulfide bonding. The immediate priority is Application 2 (Biochemical Characterization) to assess the protein's physical properties through CD spectroscopy and SEC analysis. Applications 1 and 3 (Antibody Development and Tag-Based Detection) can proceed immediately. Interaction studies must be avoided entirely due to the high probability of misfolding. For functional inhibitor studies, alternative approaches using eukaryotic expression systems (e.g., plant-based or yeast systems) or native purification from wheat are essential. 

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Secreted.
Protein Families
Protease inhibitor I6 (cereal trypsin/alpha-amylase inhibitor) family
Database Links

UniGene: Ta.56900

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*