Recombinant Trypanosoma cruzi Heat shock protein 100 (HSP100), partial

In Stock
Code CSB-EP517681TQY
Abbreviation Recombinant Trypanosoma cruzi HSP100 protein, partial
MSDS
Size US$388
Order now
Image
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP517681TQY could indicate that this peptide derived from E.coli-expressed Trypanosoma cruzi HSP100.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP517681TQY could indicate that this peptide derived from E.coli-expressed Trypanosoma cruzi HSP100.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
HSP100
Uniprot No.
Research Area
Signal Transduction
Alternative Names
HSP100Heat shock protein 100; Protein CLP; Fragment
Species
Trypanosoma cruzi
Source
E.coli
Expression Region
1-138aa
Target Protein Sequence
NSPKGLEATREKVWQVVRSYFRPEFLNRLDDIVLFRRLGFGELHEIIDLIVAEVNGRLRSQDILLEVTDEAKNFVLENAFDAEMGARPLRRWVEKYITTEVSRMILAQQLPPNSTVRVLVNGSQGKLAFSVKRSFVSE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.9 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Producing recombinant Trypanosoma cruzi Heat shock protein 100 (HSP100) in E. coli involves multiple steps. Initially, the gene encoding the partial HSP100 protein (1-138aa) is co-cloned into an expression vector with an N-terminal 10xHis-tag and C-terminal Myc-tag gene and transformed into E. coli cells. The bacteria are grown under specific conditions to induce protein expression. Cells are harvested and lysed to release the recombinant HSP100 protein. Purification is achieved using the affinity chromatography method. Protein purity is assessed using SDS-PAGE,exceeding 90%.

HSP100 in T. cruzi is part of a broader family of heat shock proteins that are conserved across different species and play critical roles in cytoprotection, differentiation, disease progression, and transmission [6]. HSPs, including HSP100, are involved in gene regulation and mRNA stability during heat shock conditions in T. cruzi [2]. These proteins are essential for stress-induced stage differentiation and are significant for disease progression and transmission [3]. The upregulation of HSP100 is observed in response to environmental stresses such as severe heat shock, leading to nucleolar accumulation of mRNAs in T. cruzi [4]. Furthermore, the induction of heat shock proteins, including HSP100, is implicated in the differentiation of T. cruzi into infective metacyclic forms, preparing the parasite for host invasion [5].

References:
[1] T. Ürményi, R. Silva, & E. Rondinelli, The heat shock proteins of trypanosoma cruzi,, p. 119-135, 2013. https://doi.org/10.1007/978-94-007-7305-9_5
[2] D. Rodrigues, R. Silva, E. Rondinelli, & T. Ürményi, Trypanosoma cruzi: modulation of hsp70 mrna stability by untranslated regions during heat shock, Experimental Parasitology, vol. 126, no. 2, p. 245-253, 2010. https://doi.org/10.1016/j.exppara.2010.05.009
[3] S. Bentley and A. Boshoff, trypanosoma bruceij protein 2 functionally cooperates with the cytosolic hsp70.4 and hsp70 proteins,, 2019. https://doi.org/10.1101/641704
[4] E. Nazer, R. Verdun, & D. Sánchez, Severe heat shock induces nucleolar accumulation of mrnas in trypanosoma cruzi, Plos One, vol. 7, no. 8, p. e43715, 2012. https://doi.org/10.1371/journal.pone.0043715
[5] A. Alcina, A. Urzainqui, & L. Carrasco, The heat‐shock response in trypanosoma cruzi, European Journal of Biochemistry, vol. 172, no. 1, p. 121-127, 1988. https://doi.org/10.1111/j.1432-1033.1988.tb13863.x

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*