Recombinant Vaccinia virus Protein B5 (PS/HR), partial

In Stock
Code CSB-YP321891VAA1
Abbreviation Recombinant Vaccinia virus PS/HR protein, partial
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
PS/HR
Uniprot No.
Research Area
Others
Alternative Names
PS/HR; B5R; Protein B5; Plaque-size/host range protein
Species
Vaccinia virus (strain Copenhagen) (VACV)
Source
Yeast
Expression Region
18-279aa
Target Protein Sequence
YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.1
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Vaccinia virus Protein B5 (PS/HR) gets expressed in yeast and comes with an N-terminal 6xHis-tag, which makes purification and detection much easier. The protein includes amino acids 18-279, creating what appears to be a partial but still functional form. SDS-PAGE analysis shows purity levels above 85%, and this product is intended for research applications where reliable performance matters.

Protein B5 acts as a structural piece of the Vaccinia virus. It plays what seems to be a crucial role in how the virus assembles and exits cells. The protein is involved in forming the viral envelope - something that's essential for releasing mature virions. Getting a better handle on how Protein B5 functions and interacts may provide useful insights into viral life cycles and could help in developing antiviral strategies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Vaccinia virus Protein B5 (PS/HR) is a viral envelope protein that requires proper folding, disulfide bond formation, and specific post-translational modifications for its functional role in viral entry and egress. The yeast expression system provides a eukaryotic environment that supports better folding than bacterial systems, but may not fully replicate the complex folding requirements of this viral protein. The partial fragment (18-279aa) represents only a portion of the full-length protein and may lack a complete structural context. While yeast expression increases the probability of correct folding compared to prokaryotic systems, experimental validation remains essential to confirm functional status.

1. Antibody Development and Validation Studies

Antibody development primarily relies on antigenic sequence recognition. If correctly folded (verified), the protein is excellent for generating conformation-sensitive antibodies that recognize native B5 epitopes. If misfolded/unverified, it remains suitable for producing antibodies against linear epitopes, though these may not efficiently detect the native protein structure in viral contexts.

2. Protein-Protein Interaction Studies

This application carries a significant risk without folding validation. Protein-protein interactions require precise tertiary structure. If correctly folded (verified), the fragment might identify domain-specific interaction partners involved in viral pathogenesis. If misfolded/unverified, the risk of non-specific binding or interaction failure makes results biologically unreliable.

3. ELISA-Based Binding Assays

ELISA applications depend on antibody-epitope recognition rather than functional conformation. If correctly folded (verified), the protein serves as an excellent standard for detecting native B5 antibodies. If misfolded/unverified, it remains suitable as an immunoassay standard for detecting immunoreactive material.

4. Biochemical Characterization Studies

These studies are essential for determining protein quality regardless of folding state. If correctly folded (verified), characterization provides insights into the protein's biophysical properties. If misfolded/unverified, analysis yields valuable physical property data for this specific preparation.

Final Recommendation & Action Plan

The yeast expression system provides better eukaryotic folding conditions than bacterial systems, but experimental validation is crucial before functional applications for this viral protein. Begin with Application 4 (Biochemical Characterization) to assess folding quality through size-exclusion chromatography, circular dichroism spectroscopy, and disulfide bond analysis. If correct folding is verified, proceed cautiously with Applications 1 (conformational antibodies) and 2 for antibody development and interaction studies. Application 3 (ELISA Standard) can proceed immediately regardless of folding status. If misfolding is detected, limit applications to linear epitope antibody production (Application 1) and basic biophysical characterization, avoiding all functional interaction studies. For reliable vaccinia virus research, consider using full-length protein from mammalian expression systems for complete functional characterization.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EEV) to allow virion entry into host cells. Participates also in wrapping intracellular mature virions (IMV) to form intracellular enveloped virions (IEV).
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host Golgi apparatus, host trans-Golgi network.
Protein Families
Receptors of complement activation (RCA) family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*