Recombinant Vaccinia virus Protein B5 (PS/HR), partial

In Stock
Code CSB-YP321891VAA1
Abbreviation Recombinant Vaccinia virus PS/HR protein, partial
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
PS/HR
Uniprot No.
Research Area
Others
Alternative Names
PS/HR; B5R; Protein B5; Plaque-size/host range protein
Species
Vaccinia virus (strain Copenhagen) (VACV)
Source
Yeast
Expression Region
18-279aa
Target Protein Sequence
YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.1
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Vaccinia virus Protein B5 (PS/HR) gets expressed in yeast and comes with an N-terminal 6xHis-tag, which makes purification and detection much easier. The protein includes amino acids 18-279, creating what appears to be a partial but still functional form. SDS-PAGE analysis shows purity levels above 85%, and this product is intended for research applications where reliable performance matters.

Protein B5 acts as a structural piece of the Vaccinia virus. It plays what seems to be a crucial role in how the virus assembles and exits cells. The protein is involved in forming the viral envelope - something that's essential for releasing mature virions. Getting a better handle on how Protein B5 functions and interacts may provide useful insights into viral life cycles and could help in developing antiviral strategies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Validation Studies

This recombinant vaccinia virus protein B5 fragment can work as an immunogen for creating polyclonal or monoclonal antibodies that target the B5 protein specifically. That N-terminal 6xHis tag makes purification straightforward and allows for easy immobilization during antibody screening assays. The protein quality appears sufficient for immunization protocols and follow-up antibody characterization, given its greater than 85% purity. Since it's expressed in yeast, the protein likely gets proper eukaryotic folding that may keep native epitopes intact - something that's important for antibody recognition.

2. Protein-Protein Interaction Studies

Researchers can use the His-tagged B5 protein fragment in pull-down assays to hunt for potential cellular binding partners or other viral protein interactions. The 6xHis tag allows researchers to stick the protein onto nickel-based resins, which then captures interacting proteins from cell lysates or purified protein libraries. This method could help clarify how vaccinia virus infection and replication actually work at the molecular level. The partial protein covers amino acids 18-279, retaining substantial sequence content that probably contains important interaction domains.

3. ELISA-Based Binding Assays

The recombinant B5 protein works well as a coating antigen in enzyme-linked immunosorbent assays for studying antibody binding patterns or hunting for B5-specific antibodies in serum samples. The His tag makes oriented immobilization on nickel-coated plates possible, which may improve how consistent the assays are. At 85% purity, this protein preparation should handle quantitative binding studies and dose-response analyses just fine. Basic research into vaccinia virus immunology would benefit from this application, as would vaccine development studies.

4. Biochemical Characterization Studies

This recombinant protein preparation opens the door for detailed biochemical analysis of the B5 protein fragment. Researchers can determine molecular weight, isoelectric point, and stability under different buffer conditions. The yeast expression system might provide post-translational modifications that are relevant to the native protein structure. Scientists can run SDS-PAGE analysis to confirm the protein is intact and check for degradation patterns under various storage conditions. This kind of characterization data would support additional experimental work and give baseline information for comparing with other vaccinia virus proteins.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EEV) to allow virion entry into host cells. Participates also in wrapping intracellular mature virions (IMV) to form intracellular enveloped virions (IEV).
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host Golgi apparatus, host trans-Golgi network.
Protein Families
Receptors of complement activation (RCA) family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*