Recombinant Vespa magnifica Hyaluronidase

In Stock
Code CSB-EP308534VBQ
Abbreviation Recombinant Vespa magnifica Hyaluronidase protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
Hyaluronidase; Hya; EC 3.2.1.35; Hyaluronoglucosaminidase; allergen Vesp ma 2
Species
Vespa magnifica (Hornet)
Source
E.coli
Expression Region
27-357aa
Target Protein Sequence
SERPKRVFNIYWNVPTFMCHQYGLYFDEVTNFNIKHNSKDNFQGDKIAIFYDPGEFPALLPLNYGKYKIRNGGVPQEGNITIHLQRFIEYLDKTYPNRNFSGIGVIDFERWRPIFRQNWGNMKIYKNFSIDLVRKEHPFWNKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYYGYPYCFNMSPTNFVPDCDVTARDENNEMSWLFNNQNVLLPSVYIRRELTPDQRIGLVQGRVKEAVRISNKLKHSPKVFSYWWYVYQDETNTFLTETDVKKTFQEIVINGGDGIIIWGSSSDVNSLSKCTRLREYLLTVLGPIAVNVTEAVN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
45.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Vespa magnifica Hyaluronidase is produced in E. coli and includes an N-terminal 6xHis-tag to simplify purification and detection. The product represents the full length of the mature protein, spanning amino acids 27 to 357. Purity levels exceed 85% as confirmed by SDS-PAGE, which appears to make it sufficiently reliable for research purposes. This product is designed exclusively for research use and is not intended for diagnostic or therapeutic applications.

Hyaluronidase from Vespa magnifica plays a key role in breaking down hyaluronic acid, a major component of the extracellular matrix. When this enzyme degrades hyaluronic acid, it may help other molecules or cells spread more easily through tissue. This characteristic suggests that hyaluronidase could serve as an important tool for studying tissue permeability and matrix biology, particularly in applications requiring enhanced tissue penetration.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Biochemical Characterization and Enzyme Kinetics Studies

This recombinant hyaluronidase can help establish fundamental biochemical properties including substrate specificity, optimal pH and temperature conditions, and kinetic parameters. The N-terminal 6xHis tag makes purification and immobilization more straightforward for detailed enzymatic studies. Researchers might investigate how the enzyme acts against various glycosaminoglycan substrates to better understand its catalytic mechanism. The >85% purity level appears sufficient for reliable biochemical assays and comparative studies with other hyaluronidases.

2. Antibody Development and Immunological Studies

The recombinant protein may serve as an effective antigen for generating specific antibodies against Vespa magnifica hyaluronidase. His-tagged protein can be incorporated into immunization protocols for monoclonal or polyclonal antibody production. These antibodies would likely prove valuable as research tools for studying hyaluronidase distribution, localization, and expression in hornet venom systems. The mature protein sequence (27-357aa) represents the native form that is likely to trigger biologically relevant immune responses.

3. Comparative Venom Component Analysis

This protein allows for comparative studies of hyaluronidase variants across different Vespa species and other venomous insects. Researchers can examine structural and functional differences between hornet hyaluronidases and those from other sources. The recombinant format permits standardized comparative assays without requiring venom extraction. Such studies may contribute to understanding evolutionary relationships and functional diversification of hyaluronidases in venomous species.

4. His-Tag Affinity-Based Interaction Studies

The N-terminal 6xHis tag makes pull-down experiments and affinity-based assays possible for identifying potential binding partners or inhibitors. Researchers can use nickel-affinity chromatography to study protein-protein interactions or screen for small molecule inhibitors. The tag also enables ELISA-based binding studies and surface plasmon resonance experiments. These applications appear particularly valuable for understanding the protein's role in venom composition and identifying potential research targets for venom component studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hydrolyzes high molecular weight hyaluronic acid to produce small oligosaccharides.
Subcellular Location
Secreted.
Protein Families
Glycosyl hydrolase 56 family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*