Recombinant Vespa magnifica Hyaluronidase

In Stock
Code CSB-EP308534VBQ
Abbreviation Recombinant Vespa magnifica Hyaluronidase protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
Hyaluronidase; Hya; EC 3.2.1.35; Hyaluronoglucosaminidase; allergen Vesp ma 2
Species
Vespa magnifica (Hornet)
Source
E.coli
Expression Region
27-357aa
Target Protein Sequence
SERPKRVFNIYWNVPTFMCHQYGLYFDEVTNFNIKHNSKDNFQGDKIAIFYDPGEFPALLPLNYGKYKIRNGGVPQEGNITIHLQRFIEYLDKTYPNRNFSGIGVIDFERWRPIFRQNWGNMKIYKNFSIDLVRKEHPFWNKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYYGYPYCFNMSPTNFVPDCDVTARDENNEMSWLFNNQNVLLPSVYIRRELTPDQRIGLVQGRVKEAVRISNKLKHSPKVFSYWWYVYQDETNTFLTETDVKKTFQEIVINGGDGIIIWGSSSDVNSLSKCTRLREYLLTVLGPIAVNVTEAVN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
45.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Vespa magnifica Hyaluronidase is produced in E. coli and includes an N-terminal 6xHis-tag to simplify purification and detection. The product represents the full length of the mature protein, spanning amino acids 27 to 357. Purity levels exceed 85% as confirmed by SDS-PAGE, which appears to make it sufficiently reliable for research purposes. This product is designed exclusively for research use and is not intended for diagnostic or therapeutic applications.

Hyaluronidase from Vespa magnifica plays a key role in breaking down hyaluronic acid, a major component of the extracellular matrix. When this enzyme degrades hyaluronic acid, it may help other molecules or cells spread more easily through tissue. This characteristic suggests that hyaluronidase could serve as an important tool for studying tissue permeability and matrix biology, particularly in applications requiring enhanced tissue penetration.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Biochemical Characterization

This recombinant hyaluronidase can be used for basic biophysical characterization, such as determining molecular weight, oligomeric state, and thermal stability using techniques like size-exclusion chromatography and circular dichroism. However, enzymatic activity studies (e.g., kinetic parameters, substrate specificity) are not recommended without prior validation of correct folding and activity, as the E. coli expression system likely produces a misfolded, inactive protein.

2. Antibody Development and Immunological Studies

This protein serves as an excellent immunogen for generating antibodies against linear epitopes of Vespa magnifica hyaluronidase. The full-length sequence ensures broad epitope coverage, and the high purity minimizes antibodies against contaminants. These antibodies will be useful for Western blotting and immunoassays under denaturing conditions.

3. Comparative Venom Component Analysis

This protein can be used for sequence-based comparisons and immunological cross-reactivity studies across species. However, comparative functional analyses (e.g., enzymatic activity differences) are invalid due to the likely misfolded state and lack of activity. Structural comparisons via SDS-PAGE or Western blotting are feasible.

Final Recommendation & Action Plan

The E. coli expression system is unsuitable for producing a functional hyaluronidase, limiting applications to non-functional uses. The immediate priority is to conduct biophysical characterization (Application 1) to assess the protein's folding state and stability. Application 2 (Antibody Development) can proceed immediately. Protein-protein interactions and inhibitor binding depend on precise tertiary structure, which this E. coli-expressed protein likely lacks. Functional comparisons require native, active enzymes, but sequence and immunological analyses are reliable based on the protein's primary structure. For reliable functional data, use hyaluronidase from eukaryotic expression systems or native venom purification.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Hydrolyzes high molecular weight hyaluronic acid to produce small oligosaccharides.
Subcellular Location
Secreted.
Protein Families
Glycosyl hydrolase 56 family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*