Recombinant Yersinia enterocolitica Protein YopB (yopB), partial

In Stock
Code CSB-EP334228YAQ1
Abbreviation Recombinant Yersinia enterocolitica yopB protein, partial
MSDS
Size US$388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
yopB
Uniprot No.
Research Area
Others
Alternative Names
yopB; Protein YopB
Species
Yersinia enterocolitica
Source
E.coli
Expression Region
1-165aa
Target Protein Sequence
MSALITHDRSTPVTGSLVPYIETPAPAPLQTQQVAGELKDKNGGVSSQGVQLPAPLAVVASQVTEGQQQEITKLLESVTRGTAGSQLISNYVSVLTNFTLASPDTFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGMASK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.9 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Yersinia enterocolitica Protein YopB is produced in E. coli and includes an N-terminal 6xHis-tag, which simplifies the purification process. This product represents a partial expression region spanning amino acids 1-165. The protein comes with purity levels above 85%, verified through SDS-PAGE analysis. Intended strictly for research purposes, this recombinant protein lacks endotoxin information.

YopB appears to be a crucial element of the Type III secretion system in Yersinia enterocolitica. It likely plays a central role in moving effector proteins into host cells. The protein seems essential for the bacterium's ability to cause disease, which makes it an attractive target for investigating bacterial infection pathways and possibly developing therapeutic approaches.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Immunological Studies

This recombinant YopB fragment may work well as an immunogen for creating polyclonal or monoclonal antibodies that specifically target Yersinia enterocolitica YopB protein. The N-terminal 6xHis tag makes purification straightforward and helps with immobilization during antibody screening assays. These antibodies could prove useful as research tools for examining YopB expression, where it localizes, and how it functions in bacterial disease studies. The partial protein sequence (1-165aa) covers a substantial portion that might harbor important antigenic sites for antibody binding.

2. Protein-Protein Interaction Studies

The 6xHis tag allows for pull-down experiments to find potential host cell proteins that bind to the YopB N-terminal region when Yersinia infects cells. Researchers can attach the recombinant protein to nickel-affinity resins and mix it with host cell extracts to catch interacting partners. This method could shed light on how YopB contributes to bacterial harm and manipulates host cells at the molecular level. The 85% purity appears adequate for these interaction experiments while reducing interference from unwanted proteins.

3. ELISA-Based Binding Assays

The His-tagged YopB fragment works in enzyme-linked immunosorbent assays to examine binding with different ligands or to test potential small molecule blockers. The protein can be placed directly on ELISA plates or captured using anti-His antibodies for uniform positioning. This approach proves particularly helpful for studying how specifically the YopB N-terminal domain binds and for measuring the timing of molecular interactions. The partial protein length offers a well-defined region for targeted binding research.

4. Biochemical Characterization and Stability Studies

This recombinant protein serves as a reasonable starting material for biochemical analysis, including heat stability, pH resistance, and sensitivity to protein-cutting enzymes in the YopB N-terminal region. The specific expression region (1-165aa) makes it possible to compare systematically with other YopB versions or similar proteins from different Yersinia species. Studies like these can reveal what structural features YopB needs to work properly and may help pinpoint critical amino acids within this region.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in virulence.
Subcellular Location
Cell membrane; Multi-pass membrane protein.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*