Recombinant Yersinia enterocolitica Protein YopB (yopB), partial

In Stock
Code CSB-EP334228YAQ1
Abbreviation Recombinant Yersinia enterocolitica yopB protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
yopB
Uniprot No.
Research Area
Others
Alternative Names
yopB; Protein YopB
Species
Yersinia enterocolitica
Source
E.coli
Expression Region
1-165aa
Target Protein Sequence
MSALITHDRSTPVTGSLVPYIETPAPAPLQTQQVAGELKDKNGGVSSQGVQLPAPLAVVASQVTEGQQQEITKLLESVTRGTAGSQLISNYVSVLTNFTLASPDTFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGMASK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.9 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Yersinia enterocolitica Protein YopB is produced in E. coli and includes an N-terminal 6xHis-tag, which simplifies the purification process. This product represents a partial expression region spanning amino acids 1-165. The protein comes with purity levels above 85%, verified through SDS-PAGE analysis. Intended strictly for research purposes, this recombinant protein lacks endotoxin information.

YopB appears to be a crucial element of the Type III secretion system in Yersinia enterocolitica. It likely plays a central role in moving effector proteins into host cells. The protein seems essential for the bacterium's ability to cause disease, which makes it an attractive target for investigating bacterial infection pathways and possibly developing therapeutic approaches.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Yersinia enterocolitica YopB is a bacterial effector protein that requires specific membrane association and interaction with other type III secretion system components for its pore-forming activity. The E. coli expression system can produce bacterial proteins, but YopB's function depends on proper insertion into membranes and interaction with YopD. The partial sequence (1-165aa) may not contain all functional domains, and the His-tag could interfere with membrane association. While the protein may be soluble, the probability of correct functional folding and activity is low without the full context of the type III secretion system.

1. Antibody Development and Immunological Studies

This recombinant YopB fragment serves as an excellent immunogen for generating antibodies against the N-terminal region of Yersinia YopB. The partial sequence provides specific epitope coverage, and the His-tag facilitates purification and screening. These antibodies will be valuable for detecting YopB in bacterial cultures or infection studies.

2. ELISA-Based Binding Assays

This protein is well-suited as an antigen for immunoassays to detect anti-YopB antibodies. However, for functional binding studies with host cell proteins, the partial length and potential misfolding make it unreliable.

3. Biochemical Characterization and Stability Studies

This is the essential first step to assess the protein's physical properties. Techniques like circular dichroism can analyze secondary structure, while thermal shift assays evaluate stability. These studies provide critical quality control data about the protein itself, not the native protein.

Final Recommendation & Action Plan

This recombinant YopB fragment is primarily valuable for antibody production and biochemical characterization but requires validation for interaction studies. The immediate priority is Application 3 (Biochemical Characterization) to assess the protein's folding state. Application 1 (Antibody Development) can proceed immediately. Application 2 should be limited to immunoassays only. A partial YopB fragment may not maintain the correct conformation for specific interactions with host proteins or bacterial partners like YopD. The His-tag may cause steric interference. Results would require validation with a full-length protein. For functional studies, a full-length protein in the context of type III secretion system components is recommended.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in virulence.
Subcellular Location
Cell membrane; Multi-pass membrane protein.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*