Recombinant African swine fever virus Major structural protein p17 (Ba71V-107)

In Stock
Code CSB-CF806121AEJ
Abbreviation Recombinant African swine fever virus Ba71V-107 protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Ba71V-107
Uniprot No.
Research Area
Others
Alternative Names
Ba71V-107; D117L; Major structural protein p17
Species
African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV)
Source
in vitro E.coli expression system
Expression Region
1-117aa
Target Protein Sequence
MDTETSPLLSHNLSTREGIKQSTQGLLAHTIARYPGTTAILLGILILLVIILIIVAIVYYNRSVDCKSSMPKPPPSYYVQQPEPHHHFPVFFRKRKNSTSLQSHIPSDEQLAELAHS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.2 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant African swine fever virus Major structural protein p17 (Ba71V-107) has been produced through an in vitro E. coli expression system, spanning the complete protein sequence from amino acids 1 to 117. The product carries an N-terminal 10xHis tag, which streamlines both purification and detection processes. SDS-PAGE analysis confirms that the protein achieves purity levels above 85%, making it well-suited for diverse research applications.

The Major structural protein p17 appears to be a crucial component of the African swine fever virus, likely playing an important role in maintaining structural integrity and coordinating assembly. Understanding how p17 functions and interacts with other components may be vital for unraveling the viral assembly pathway and developing antiviral strategies. Research into this protein seems essential for virology studies, particularly when investigating viral replication and pathogenesis mechanisms.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

African swine fever virus p17 is a major structural protein that requires precise folding, proper oligomerization, and specific protein-protein interactions for its role in viral capsid assembly. The in vitro E. coli expression system (cell-free) provides a controlled environment but cannot ensure proper eukaryotic folding patterns or the complex oligomerization required for this viral structural protein. While cell-free systems can produce soluble proteins, the probability of correct folding with functional capsid assembly activity requires experimental validation. The N-terminal 10xHis-tag may potentially interfere with the protein's oligomerization interfaces or functional domains.

1. Antibody Development and Validation Studies

This application is highly suitable as antibody development primarily relies on linear epitope recognition rather than functional protein folding. The full-length protein (1-117aa) provides comprehensive epitope coverage for generating antibodies against p17. The high purity (>85%) ensures minimal contamination-related issues during immunization protocols.

2. Protein-Protein Interaction Studies

This application carries a significant risk without proper folding validation. p17 interactions with other viral structural proteins require precise tertiary structure and proper oligomerization. If correctly folded and active (verified), the protein may be suitable for interaction studies. If misfolded/unverified, there is a high risk of non-specific binding or failure to identify genuine physiological interactions important for viral assembly.

3. Structural and Biochemical Characterization

These studies are essential priority applications for determining folding status. Techniques should include size-exclusion chromatography to assess oligomeric state, circular dichroism spectroscopy to evaluate secondary structure, and thermal shift assays to determine stability. These analyses provide critical quality control data for this protein itself, not the native p17.

4. Immunoassay Development and Optimization

This application is well-suited as immunoassays depend on epitope recognition rather than functional conformation. The protein can serve as a reliable standard for quantitative assay development, and the His-tag provides flexible detection options for assay optimization.

5. Viral Assembly and Morphogenesis Studies

This application carries a high risk without functional validation. Viral capsid assembly requires precise oligomerization and protein-protein interactions that depend on native conformation. If incorrectly folded, the protein will not exhibit proper self-assembly characteristics, making morphogenesis studies biologically misleading.

Final Recommendation & Action Plan

The in vitro E. coli expression system provides a controlled production environment for this viral structural protein, but the folding status and functional competence require experimental validation before meaningful biological applications. Begin with Application 3 (Structural Characterization) to assess folding quality through SEC (oligomerization state), CD spectroscopy, and validate self-assembly capability if possible. Applications 1 and 4 (antibody development and immunoassay) can proceed immediately. For Applications 2 and 5 (interaction studies and assembly research), first confirm proper folding and oligomerization through biophysical characterization. Always include appropriate controls and consider using eukaryotic expression systems for critical functional studies requiring authentic viral protein behavior.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Essential for the correct processing of both structural polyproteins and for the maturation of viral precursor membranes at the viral factories.
Subcellular Location
Virion membrane; Single-pass membrane protein. Host endoplasmic reticulum membrane; Single-pass membrane protein.
Protein Families
Asfivirus major structural protein p17 family
Database Links

KEGG: vg:22220336

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*