Recombinant Arabidopsis thaliana Potassium channel KAT1 (KAT1)

Code CSB-CF657880DOA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
KAT1
Uniprot No.
Alternative Names
KAT1; At5g46240; MPL12.2; Potassium channel KAT1
Species
Arabidopsis thaliana (Mouse-ear cress)
Expression Region
1-677
Target Protein Sequence
MSISWTRNFFERFCVEEYNIDTIKQSSFLSADLLPSLGARINQSTKLRKHIISPFNPRYR AWEMWLVLLVIYSAWICPFQFAFITYKKDAIFIIDNIVNGFFAIDIILTFFVAYLDSHSY LLVDSPKKIAIRYLSTWFAFDVCSTAPFQPLSLLFNYNGSELGFRILSMLRLWRLRRVSS LFARLEKDIRFNYFWIRCTKLISVTLFAIHCAGCFNYLIADRYPNPRKTWIGAVYPNFKE ASLWNRYVTALYWSITTLTTTGYGDFHAENPREMLFDIFFMMFNLGLTAYLIGNMTNLVV HWTSRTRTFRDSVRAASEFASRNQLPHDIQDQMLSHICLKFKTEGLKQQETLNNLPKAIR SSIANYLFFPIVHNIYLFQGVSRNFLFQLVSDIDAEYFPPKEDIILQNEAPTDLYILVSG AVDFTVYVDGHDQFQGKAVIGETFGEVGVLYYRPQPFTVRTTELSQILRISRTSLMSAMH AHADDGRVIMNNLFMKLRGQQSIAIDDSNTSGHENRDFKSMGWEEWRDSRKDGYGLDVTN PTSDTALMDAIHKEDTEMVKKILKEQKIERAKVERSSSETAGRSYANDSSKKDPYCSSSN QIIKPCKREEKRVTIHMMSESKNGKLILLPSSIEELLRLASEKFGGCNFTKITNADNAEI DDLDVIWDGDHLYFSSN
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Highly selective inward-rectifying potassium channel. This voltage-gated channel could mediate long-term potassium influx into guard cells leading to stomatal opening. Assuming opened or closed conformations in response to the voltage difference across the membrane, the channel is activated by hyperpolarization. The channel activity is enhanced upon external acidification. Also permeable to ammonium ions. Blocked by tetraethylammonium and barium ions.
Gene References into Functions
  1. Data show that in KAT-type K(+) channel KAT1, residue K85 within the linker forms a hydrogen bond with C211 that enables the pH activation. PMID: 26846460
  2. Plant stress metabolite acrolein inhibits light-induced stomatal opening through inhibition of KAT1 potassium channels in Arabidopsis thaliana. PMID: 25144495
  3. Mutations of the central Phe residue favored the closed KAT1 channel, whereas mutations affecting the countercharge centers favored the open channel PMID: 25185120
  4. instead of single key amino acids, several titratable residues contribute to the pH-sensor of the plant Kin channel KAT1 PMID: 22070190
  5. trafficking of KAT1 has been shown to depend on ER export signals PMID: 20712625
  6. Results indicate that, in plant cells, a kinase analogous to protein kinase C might exist that may modulate KAT1 channel activity through calcium-dependent phosphorylation at some of the pinpointed residues in the cytosolic region of KAT1. PMID: 20423459
  7. Phosphatidylinositol phosphates were identified as essential regulators for the voltage-dependent and -independent activation of A. thaliana potassium channels expressed in X. laevis oocytes. [KAT1] PMID: 15842627
  8. KAT1 was expressed in mammalian HEK293 cells and measured with patch clamp technology in the whole cell configuration. The data show that a depletion of extracellular potassium results in a decrease in channel conductance. PMID: 16263909
  9. This study demonstrated trafficking of plant plasma membrane ion channels is controlled via a conserved mechanism. PMID: 16950859
  10. Structure prediction for the down state of the Kat1 voltage sensor PMID: 17187053
  11. Study reports that the hormone abscisic acid, which controls ion transport and transpiration in plants under water stress, triggers the selective endocytosis of the KAT1 K+ channel protein in epidermal and guard cells. PMID: 17683934
  12. The combination use of the selected detergents enabled the effective purification of functional KAT1 with affinity and gel-filtration chromatography. PMID: 18638455

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Potassium channel family, Plant (TC 1.A.1.4) subfamily
Tissue Specificity
Expressed in guard cells, and in roots.
Database Links

KEGG: ath:AT5G46240

STRING: 3702.AT5G46240.1

UniGene: At.305

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1