Recombinant Bacillus subtilis Uncharacterized MscS family protein YhdY(yhdY)

Code CSB-CF517455BRJ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O07594
Storage Buffer Tris-based buffer,50% glycerol
Species Bacillus subtilis (strain 168)
Sequence MPDYLQQYFTLDNIIQIGISLAILLVFLILRKLFTRYFFNLLFNLTNRPKTEIFKQVVLA FDKPARWFFVALGLFLAIRYSPFLDEQMPVISKIYRSLIVALLCWGLCNLTATSSFIFHK VNQRFELDMDDILAPFLSKLLRFVIIALSVSVIAQEFNYDVNGFVAGLGLGGLAFALAAK DTISNFFGGIIIITEKPFTIGDWVETSTVTGSVEDITFRSTRFRTAQGALVTVPNSTLSM EAITNWTRMTKRQITFSIHVSYATPIENLERSIHSLRTMLLEHEGVDNEIIMVNFDTFAD SYYNLFFNFYTKTTVWAENLNIREDINYKIIEILGAEGVQFAYPGQMVVVKQKHESDQFQ VNLNKEEKERA
Source in vitro E.coli expression system
Gene Names yhdY
Protein Names Recommended name: Uncharacterized MscS family protein YhdY
Expression Region 1-371
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play a role in resistance to osmotic downshock.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families MscS (TC 1.A.23) family
Database Links

KEGG: bsu:BSU09640

STRING: 224308.Bsubs1_010100005381

Related Products

yhdY Proteins

yhdY Proteins for Bacillus subtilis (strain 168)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.