Recombinant Bovine Cystinosin(CTNS)

Code CSB-CF006174BO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. A7MB63
Storage Buffer Tris-based buffer,50% glycerol
Species Bos taurus (Bovine)
Sequence MIRRWLVIFILFPLQLIEKCESTVDFSVPPIVKLEKGSSTSVSISLPRPLNATLVITFEI TFRSKNVTILQLPDEVVVPPGTTNSSFRVTSQSVGQVTTYLHGNHSNQTSPRIRFLVIHS NIVSIINQVIGWIYFVAWSVSFYPQVITNWRRKSVVGLSFDFVVLNLMGFVAYSVFNIGL FWVPSIKEQFLLKYPNGVNPVDSNDVFFSLHAVALTLVVIVQCLLYERGSQRVSWLAISF LVLSWLFTLIALIMAAVGATTWLQFLFCFSYIKLAVTLVKYFPQAYMNFHYKSTEGWSIG NVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKFGLGIFSIIFDVVFFIQHFCLYRKK PGYDQLN
Source in vitro E.coli expression system
Gene Names CTNS
Protein Names Recommended name: Cystinosin
Expression Region 1-367
Tag Info N-terminal 10xHis-tagged
Protein Description Full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cystine/H(+) symporter thought to transport cystine out of lysosomes. Plays an important role in melanin synthesis, possibly by preventing melanosome acidification and subsequent degradation of tyrosinase TYR.
Subcellular Location Lysosome membrane, Multi-pass membrane protein, Melanosome
Protein Families Cystinosin family
Database Links

KEGG: bta:613527

STRING: 9913.ENSBTAP00000049590

UniGene: Bt.13509

Related Products

CTNS Proteins

CTNS Proteins for Bos taurus (Bovine)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.