Product Details

Target Names

CYP51A1

Uniprot No.

Alternative Names

CYP51A1; Lanosterol 14-alpha demethylase; LDM; CYPLI; Cytochrome P450 51A1; Cytochrome P450-14DM; Cytochrome P45014DM; Cytochrome P450LI; Sterol 14-alpha demethylase

Species

Bos taurus (Bovine)

Expression Region

1-502

Target Protein Sequence

MLDLLQAGGSVLGQAMEQVTGGNLASMLLIACAFTLSLVYLFRLAVGHLAPPLPTGAKSP PYIVSPIPFLGHAIAFGKSPIEFLEDAYEKYGPVFSFTMVGKTFTYLLGSEAAALLFNSK NEDLNAEEVYSRLTTPVFGKGVAYDVPNTVFLEQKKMLKSGLNIAHFRQHVSIIEKETKE YFKSWGESGEKNLFEALSELIILTASHCLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLL PGWLPLPSFRRRDRAHREIKNIFYKAIQKRRESGEKIDDILQTLLESTYKDGRPLTDDEV AGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQEKCFLEQKTVCGENLPPLTYDQLKDLN LLDRCIKETLRLRPPIMTMMRLAKTPLTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLDF NPDRYLEDSPASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPT VNYTTMIHTPEKPIIRYKRRSK

Protein Length

full length protein

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Is this the full length protein, biologically active?

Very nice to receive your inquiry.
1. It's a full length protein.
2. Activity: We haven't test the activity of this protein. So we can't gurantee.

Target Background

Function

A cytochrome P450 monooxygenase involved in sterol biosynthesis. Catalyzes 14-alpha demethylation of lanosterol and 24,25-dihydrolanosterol likely through sequential oxidative conversion of 14-alpha methyl group to hydroxymethyl, then to carboxylaldehyde, followed by the formation of the delta 14,15 double bond in the sterol core and concomitant release of formic acid. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).

Subcellular Location

Endoplasmic reticulum membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein.

Protein Families

Cytochrome P450 family

Database Links

KEGG: bta:505060

STRING: 9913.ENSBTAP00000002582

UniGene: Bt.49631

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-CF703002BO
MSDS	MSDS Datasheet
Size	Pls inquire
Source	in vitro E.coli expression system
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Bovine Lanosterol 14-alpha demethylase (CYP51A1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage