Recombinant Dictyostelium discoideum Metabotropic glutamate receptor-like protein A(grlA)

Code CSB-CF690825DKK
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q55AP1
Storage Buffer Tris-based buffer,50% glycerol
Species Dictyostelium discoideum (Slime mold)
Sequence LKQCKISVLLSGDWSDMGYNYQMNNARIKAESALNLEMSLCYKNLEVSIDLAKQAIEDSI KKGANFIVISSSVHTSIGYEYARLHRDKDIYWLIRGRGRPVPDDLPKVAVINFNTHLLHY TLGLVSGYLTTSGTVGFISPGPQILALANSNSFYLGALASRKNVTFLNAYTGSWYNPEVA YKASQMLISNGADFIGMSQDDMSVQKALMDSGKMALGITGFSNRLIWGSDIALSYITDWS DVFIKYAGHILNDTWPEYTDYYTTLAEGGSLLFDTFSYRVPSEVQKLVSLEIEKLKNSSY QPFRCNPMYSQINLNFDSNGCANDMEFKNTKLLLKGTDISKTINLGLYTIPIEFVDYSNS MKLGLTIVSGFCILFCIISMVLVIMFRHAKIIKSASPIFCLLILFGCIIIFSGCIIFSLS PTDGICGARVWLLSIGYTIFLGSLLVKNWRIWLLFDNPKLKKRSITNWKLYPFVAGILAA DVLILALWQGLGDIRSESRIGIDSLTKYQYANVCSSNDQGSVALYILLVFHGIKLLAACF ISFKIKAVDIEEFNESKPIASSIYIITFCLFIVIPLMVSPQSVASQVITIVVCAIVTTLI SISLLFGSKFYMMATQGLALNQTFATNTKSSSFSLSLEKQKSKSNGLEFEDSDESEEKLP QIKNYSNSEIPNLQHNHSRLAHFSSDSCTSAEQDSKLDLENQNDENEIENNQNNQNNIVE DCQKVEKLEKDENLEKDENLEKDENLEKDNENQSIIQKKRLSKNFNQSEIDPDDV
Source in vitro E.coli expression system
Gene Names grlA
Protein Names Recommended name: Metabotropic glutamate receptor-like protein A
Expression Region 24-798
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May play an important role in the terminal differentiation.
Subcellular Location Membrane, Multi-pass membrane protein, Cytoplasm, cell cortex, Cytoplasm, perinuclear region
Protein Families BMP lipoprotein family; G-protein coupled receptor 3 family, GABA-B receptor subfamily
Database Links

KEGG: ddi:DDB_G0271684

STRING: 44689.DDB0231963

Related Products

grlA Proteins

grlA Proteins for Dictyostelium discoideum (Slime mold)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.