Recombinant Dopamine receptor 3(dop-3)

Code CSB-CF733804CXX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q61H86
Storage Buffer Tris-based buffer,50% glycerol
Species Caenorhabditis briggsae
Sequence MLTGQHHIPGIESPLMVVLWRVAAGVFLPLVPTMAVFGNVLVILSVYRERNLQTVTNMLI VSLAVSDLFVAIGVMSFGVYYEWNGFKWGLGSFFCHVYQALDVACSTASILNLLAISLDR YIAIGHPISYAQYGARGGRAMISITIVWGVSCAVALPLLLGVNPMENDQCELANPWFNMI SSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSETDKISSALLGGAQIARQMGK HFKNRTDQILLEISFQTSSFPTISESSDDGSTISPMINSFNNFLPKKSQYPSTLIPAIPE CGSMPNLTIIERPAPPEKEKDIELSIMDLHDTVEMLDDKYTSAMITRSFGEELEEILPFI DGSTSVKNSREQLHATRSNTSTTRLLDVKPELRSISVPSIQDEKKMNSRPPENPFAHQNG TNKQRLLPNPGILMKSKSTTLLKTNGYLDTDSLNNNRNSHKKSTADLLPNDDYSFTDSMR VYKNRLFKSLSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLPFFI LHLSNSICLVIDSNSDCIGFLPLYLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILSCGF FKKR
Source in vitro E.coli expression system
Gene Names dop-3
Protein Names Recommended name: Dopamine receptor 3
Expression Region 1-604
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for dopamine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. In terms of antagonist responses, would be classed with the D2-like dopamine receptor group. Mediates the effect of dopamine on the inhibition of locomotion. Acts as an antagonist of dop-1 (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

STRING: 6238.CBG10841

Related Products

dop-3 Proteins

dop-3 Proteins for Caenorhabditis briggsae

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.