Recombinant Dopamine receptor 3(dop-3)

Code CSB-CF733804CXX
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q61H86
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Caenorhabditis briggsae
Sequence MLTGQHHIPGIESPLMVVLWRVAAGVFLPLVPTMAVFGNVLVILSVYRERNLQTVTNMLI VSLAVSDLFVAIGVMSFGVYYEWNGFKWGLGSFFCHVYQALDVACSTASILNLLAISLDR YIAIGHPISYAQYGARGGRAMISITIVWGVSCAVALPLLLGVNPMENDQCELANPWFNMI SSIFSFFIPCIAMIILYTIIFRRLRQRERARSLRQAQRSETDKISSALLGGAQIARQMGK HFKNRTDQILLEISFQTSSFPTISESSDDGSTISPMINSFNNFLPKKSQYPSTLIPAIPE CGSMPNLTIIERPAPPEKEKDIELSIMDLHDTVEMLDDKYTSAMITRSFGEELEEILPFI DGSTSVKNSREQLHATRSNTSTTRLLDVKPELRSISVPSIQDEKKMNSRPPENPFAHQNG TNKQRLLPNPGILMKSKSTTLLKTNGYLDTDSLNNNRNSHKKSTADLLPNDDYSFTDSMR VYKNRLFKSLSRATSGWNKPRPSRHMVKKATKQMRREHKATVTLAVVLAVFLFCWLPFFI LHLSNSICLVIDSNSDCIGFLPLYLATWLGYLNSSLNPLIYTVFDQRFRNAFRNILSCGF FKKR
Source in vitro E.coli expression system
Gene Names dop-3
Protein Names Recommended name: Dopamine receptor 3
Expression Region 1-604
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for dopamine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. In terms of antagonist responses, would be classed with the D2-like dopamine receptor group. Mediates the effect of dopamine on the inhibition of locomotion. Acts as an antagonist of dop-1 (By similarity).
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

STRING: 6238.CBG10841

Related Products

dop-3 Proteins

dop-3 Proteins for Caenorhabditis briggsae

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.