Recombinant Drosophila melanogaster Putative odorant receptor 7a(Or7a)

Code CSB-CF892935DLU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9W3I5
Storage Buffer Tris-based buffer,50% glycerol
Species Drosophila melanogaster (Fruit fly)
Sequence MAVSTRVATKQEVPESRRAFRNLFNCFYALGMQAPDGSRPTTSSTWQRIYACFSVVMYVW QLLLVPTFFVISYRYMGGMEITQVLTSAQVAIDAVILPAKIVALAWNLPLLRRAEHHLAA LDARCREQEEFQLILDAVRFCNYLVWFYQICYAIYSSSTFVCAFLLGQPPYALYLPGLDW QRSQMQFCIQAWIEFLIMNWTCLHQASDDVYAVIYLYVVRIQVQLLARRVEKLGTDDSGQ VEIYPDERRQEEHCAELQRCIVDHQTMLQLLDCISPVISRTIFVQFLITAAIMGTTMINI FIFANTNTKIASIIYLLAVTLQTAPCCYQATSLMLDNERLALAIFQCQWLGQSARFRKML LYYLHRAQQPITLTAMKLFPINLATYFSIAKFSFSLYTLIKGMNLGERFNRTN
Source in vitro E.coli expression system
Gene Names Or7a
Protein Names Recommended name: Putative odorant receptor 7a
Expression Region 1-413
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor which mediates acceptance or avoidance behavior, depending on its substrates. The odorant receptor repertoire encodes a large collection of odor stimuli that vary widely in identity, intensity, and duration. May form a complex with Orco to form odorant-sensing units, providing sensitive and prolonged odorant signaling and calcium permeability. Highly sensitive to the sex pheromone of the silkworm moth, bombykol. Intriguingly, the fruit fly detectors are more sensitive than the receptors of the silkworm moth, although its ecological significance is unknown. Responds also to pyrazines.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Insect chemoreceptor superfamily, Heteromeric odorant receptor channel (TC 1.A.69) family, Or2a subfamily
Tissue Specificity Expressed in olfactory sensory neurons in the antenna.
Database Links

KEGG: dme:Dmel_CG10759

STRING: 7227.FBpp0071134

UniGene: Dm.26486

Related Products

Or7a Antibodies

Or7a Antibodies for Drosophila melanogaster (Fruit fly)

Or7a Proteins

Or7a Proteins for Drosophila melanogaster (Fruit fly)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.