Recombinant Erwinia carotovora subsp. atroseptica Zinc transport protein ZntB(zntB)

Code CSB-CF735229EAAB
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q6D5P8
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)
Sequence MESFAGKELQHSGAVHAYQLDGKGGITPIGEQDVVNSEKPCWLHLDSTVPASARWLNKTL VVPDSVRTALAGESVRPRVTRLGEGTLITLRSINLNANARPDQLVAVRVFITDKLIISTR RRKILAIDEILTDLKEGNGPTDSGNWLVSIAEALTDHTSEFIDDLHEKIIDLEDDLLEQK IPPRGELALIRKQLIVLRRYMTPQRDVFSRISGEKLPWMQDDDRRRMQEIADRLGRGLED LDASVARTTVLSDEITALMTEAMNRRTYTMSLLAMVFLPTTFLTGLFGVNLGGIPGGDAP FGFFTFCLMLVILVGGVAWWLKRSKWL
Source in vitro E.coli expression system
Gene Names zntB
Protein Names Recommended name: Zinc transport protein ZntB
Expression Region 1-327
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Mediates efflux of zinc ions.
Subcellular Location Cell inner membrane, Multi-pass membrane protein
Protein Families CorA metal ion transporter (MIT) (TC 1.A.35) family
Database Links

KEGG: eca:ECA1993

STRING: 218491.ECA1993

Related Products

zntB Proteins

zntB Proteins for Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.