Recombinant Gadus morhua Melanopsin-A(opn4a)

Code CSB-CF801907GER
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q804X9
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Gadus morhua (Atlantic cod)
Sequence MRPSTDTMEADTAATHRNFITKVDVPDHAHYTVAFFVSVIGTLGVTGNALVQFAFYSNKK LRNLPNYFIMNQAASDFLMAFTQSPFFFINCLNREWIFGELGCKLYAFLGALFGITSMIN LLAISLDRYMVITRPLEAMKWNSKRRTTIAILLVWLYSLAWSLAPLVGWSSYIPEGLRTS CTWDYVTYTASNRSYTMMLCCFVFFIPLAIISYCYLFMFLAIRKTSRDVERLGIQVRKST IIRQKSIRTEWKLAKIAFVVIVVYVLSWSPYACVTMISWSGHANILSPYSKTVPAVIAKA STIYNPFIYAIIHQKYRKTLADKVPCLRFLAPNKRKDCTSSSFSGSSYRDSVISRTSTAI RRQSTAASRHASASKTAAGASSYSSSDRVFGDVEMDPIDWRSGASFRRHSSRGSTRRDRL LKKQQMERTNKSAAHKQPSPSTKMSATHCKNKTVSSSVNMAAAPPQLVLIRKRSQSLTNG LSDAGKKTTVANGTPGNHKSKSADLHFRNLPALDQALNVPRIIVISPTSEDCLVKHESSF TDDGSVGTVVDEDSLEDNDVV
Source in vitro E.coli expression system
Gene Names opn4a
Protein Names Recommended name: Melanopsin-A Alternative name(s): Opsin-4A
Expression Region 1-561
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Photoreceptor implicated in non-image-forming responses to light.
Subcellular Location Membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family, Opsin subfamily
Tissue Specificity Expressed in retina and brain. Expressed in a subset of retinal horizontal cells as well as a small number of amacrine and retinal ganglion cells. Also expressed in a small population of neurons in the suprachiasmatic nucleus (SNC).

Related Products

opn4a Proteins

opn4a Proteins for Gadus morhua (Atlantic cod)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.