Recombinant Gorilla gorilla gorilla Olfactory receptor 1E2(OR1E2)

Code CSB-CF879982GGZ
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9TQX4
Storage Buffer Tris-based buffer,50% glycerol
Species Gorilla gorilla gorilla (Western lowland gorilla)
Sequence MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPMY LFLSNLSFSDLCFSSVTIPKLLQNMQNQDPSIPYADCLTQMYFFLLFGDLESFLLVAMAY DRYVAICFPLHYTAIMSPMLCLSLVALSWVLTTFHAMLHTLLMARLCFCADNVIPHFFCD MSALLKLACSDTRVNEWVIFIMGGLIVVIPFLLILGSYARIVSSILKVPSSKGICKAFST CGSHLSVVSLFYGTIIGLYLCPSANSSTLKETVMAMMYTVVTPMLNPFIYSLRNRDMKGA LERVICKRKNPFLL
Source in vitro E.coli expression system
Gene Names OR1E2
Protein Names Recommended name: Olfactory receptor 1E2
Expression Region 1-314
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Odorant receptor.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Database Links

STRING: 9593.ENSGGOP00000017689

Related Products

OR1E2 Proteins

OR1E2 Proteins for Gorilla gorilla gorilla (Western lowland gorilla)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.