Recombinant Guinea pig Potassium channel subfamily K member 9(KCNK9)

Code CSB-CF881343GU
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. Q9JL58
Storage Buffer Tris-based buffer,50% glycerol
Species Cavia porcellus (Guinea pig)
Sequence MKKQNVRTLSLIACTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIRGKYNISTEDYR QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTEVSMENMVTVGFFSCMGTLCIGAAAFSQ CEEWSFFHAYYYCFITLTTIGFGDYVALQSKGALQRKPFYVAFSFMYILVGLTVIGAFLN LVVLRFLTMNSDEERGEGEEGAALPGNPSSVVTHISEEARQVRQRYRGEGGDLQSVCSCA CYRSQPQNFGATLAPQPLHSISCRIEEISPSTLKNSLFPSPISSVSPGLHSFGDNHRLML RRKSV
Source in vitro E.coli expression system
Gene Names KCNK9
Protein Names Recommended name: Potassium channel subfamily K member 9 Alternative name(s): Acid-sensitive potassium channel protein TASK-3 TWIK-related acid-sensitive K(+) channel 3
Expression Region 1-365
Tag Info N-terminal 10xHis-tagged
Protein Description full length protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function pH-dependent, voltage-insensitive, background potassium channel protein.
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families Two pore domain potassium channel (TC 1.A.1.8) family
Tissue Specificity Highly expressed in the brain.
Database Links

STRING: 10141.ENSCPOP00000017207

Related Products

KCNK9 Proteins

KCNK9 Proteins for Cavia porcellus (Guinea pig)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.